DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and IMO32

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_011545.1 Gene:IMO32 / 852919 SGDID:S000003263 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:68/324 - (20%)
Similarity:113/324 - (34%) Gaps:110/324 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PILAIHGWLDNLGTFDRLIPLLPDYIG--VLCIDLPGHGRSAHIQPGMHYAVNDYVLIIPRVMKE 92
            ||:.:||...|......:...|...:|  |..:||..||.|.      |.:|::|     .||.|
Yeast    76 PIIILHGLFGNKLNNRSIGRNLNKKLGRDVYLLDLRNHGSSP------HSSVHNY-----EVMSE 129

  Fly    93 ---YGWSKVSL--------MGHSLGGIISFVYTSLAPDTVDMVISLD-----------------I 129
               :..:|..|        :|||:||.::.:.....|....|::.::                 .
Yeast   130 DVKHFITKHELNTNGGPIIIGHSMGGKVAMMLVLKNPQLCSMLVCIENAPVSLRPNAEFVEYIKA 194

  Fly   130 LLPLSKDPKTVIKYLNHSLDKHLVEE---------------ERQVEGNLHEPPSYT------LAQ 173
            |:.:..|....|:.|..: |:||.|.               ::....|.....|||      ||.
Yeast   195 LMEIVNDKGKTIRTLKQA-DEHLAERIGGNELVRRFLLTALKKVKMDNSSSVSSYTFEERIPLAT 258

  Fly   174 LTQVLAKGSDNSVTPEFAQHLLHRQVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGEALVKRIR 238
            |...:.||                :::...|.|.|..::|                         
Yeast   259 LKDAIVKG----------------EIAAWPLDPARERWTR------------------------- 282

  Fly   239 RIPCLIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFIRHH 302
              |.|.|:.::|.:|   .::.:.|:....|.||..:::.| |.|:.....|||..||.|:..|
Yeast   283 --PALFIRATQSHYV---VDEYLPIIGAFFPRFETRDIDAG-HWVNAEKPGECAESIVDFVERH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 67/322 (21%)
Abhydrolase 47..>109 CDD:304388 21/74 (28%)
IMO32NP_011545.1 PRK10673 74..326 CDD:182637 61/308 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.