DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and EAT1

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_011529.1 Gene:EAT1 / 852898 SGDID:S000003247 Length:328 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:69/302 - (22%)
Similarity:122/302 - (40%) Gaps:50/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERP-ILAIHGWLDNLGTFDRLIPLLPDYI--GVLCIDLPGHGRSAHIQPGMHYAV-NDYVLIIPR 88
            :|| |:.|||.|.:...|..|..||...:  .:..:|:..||.|....|..:..: ||.:..|. 
Yeast    37 QRPAIINIHGLLGSHVMFHSLNKLLSRKLDADIFSVDVRNHGISPKAIPYDYTTLTNDLIYFIE- 100

  Fly    89 VMKEYGWSK-VSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYL-NHSLDKH 151
              ...|..: :.|:|.|:||.|:.:.|......:...||:|  ||..:.|:.....| |:.|...
Yeast   101 --THIGLERPIYLLGFSMGGKIALLTTLYKNINIRKCISID--LPPYETPELDPMILQNYDLIMR 161

  Fly   152 LVEEERQVEGNLHEPPSY-----TLAQLTQVLAKGSDNSVTPEFAQHLL---HRQVSKSQLYPDR 208
            ::..:.::   |...||:     .|.:..:...:....:|...||...|   ...|.::||:.::
Yeast   162 IIRRDVKI---LRGSPSWQKKVLELFKSLECNKRKCGGAVALYFANGFLSVKSNNVHQAQLHYEQ 223

  Fly   209 FFFSRDGRVKYYSHLQMEPEFGEALVKRIRRIP-----------------CLIIKGSKSDFVEAR 256
              ...|..:.|...|...|.    |:..:::.|                 .|.:||.:|:|:   
Yeast   224 --QQHDPYINYSMPLSSMPN----LLDEVKKWPDLSNQRDFFQKGTASRKVLFMKGLQSNFI--- 279

  Fly   257 TEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPF 298
             ....::||.|.|..:..|...| |::.|...|:..:.|:.|
Yeast   280 -NNDYSLLRYNFPCADVREFNTG-HNLLLENPEDSFKCILNF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 69/301 (23%)
Abhydrolase 47..>109 CDD:304388 17/65 (26%)
EAT1NP_011529.1 Abhydrolase_1 39..309 CDD:395444 65/288 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.