DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and LDH1

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_009763.2 Gene:LDH1 / 852503 SGDID:S000000408 Length:375 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:43/150 - (28%)
Similarity:67/150 - (44%) Gaps:29/150 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNRTERPILAIHGWLDNLGTFDRLIPLL-PDYIGVLCIDLPGHGRSAHIQ--PGMHYAVNDYVLI 85
            |.|.:...:.:.|...||..|:.|:.|: .|....|.:||||.|.|:...  |.:......:||:
Yeast    82 GIRGDTVFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLV 146

  Fly    86 IPRVMKEYGWS---------------KVSLMGHSLGGIIS-FVYTSLAPDTVDMVISLDILLPLS 134
            ...:.|   ||               |:.|:|||:|..:: .:|.....|| ..|.:|.:|.|  
Yeast   147 CDVLRK---WSTAVPNNDNVNPFNGHKIVLVGHSMGCFLACHLYEQHMADT-KAVQTLVLLTP-- 205

  Fly   135 KDPKTVIKYLNHSLDKHLVE 154
              ||..|:.|  |.|||:::
Yeast   206 --PKAHIEQL--SKDKHIIQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 41/144 (28%)
Abhydrolase 47..>109 CDD:304388 22/79 (28%)
LDH1NP_009763.2 EstA 4..375 CDD:224001 43/149 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.