DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and ECM18

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_010410.3 Gene:ECM18 / 851703 SGDID:S000002532 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:384 Identity:74/384 - (19%)
Similarity:133/384 - (34%) Gaps:136/384 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HISG------------RWY----GNRTER-PILAIHGWLDNLGTFDRLIPLLPDYI-GVLCIDLP 63
            |:.|            :|:    ...|.| |.|.|||:..:..:|.|..|.|..:| .:..||:|
Yeast    98 HVEGIKKNDKLFNEINQWHFQNENTSTVRTPTLLIHGYAASSMSFFRNYPGLSKHIRNLYSIDMP 162

  Fly    64 GHGRSAHIQPGMH----------------------YAVN------------DYVLIIPRVMKEYG 94
            ..|.|:  .|.:.                      |.:|            |:.|  .|:.:   
Yeast   163 ASGLSS--VPSLEINTTTPLPLDIKFIGENKFKVPYTINANHNKFVIQMYEDFYL--DRIEQ--- 220

  Fly    95 W------SKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLS------------------- 134
            |      .|::::|||.||.:||.|....|::|:   .|.::.||.                   
Yeast   221 WRIDNKLGKMNVVGHSFGGYLSFKYAVKYPNSVN---KLCLVSPLGVERNIWSVNNNFHSNTLYT 282

  Fly   135 ---KDPKTVIKYLNHSLDKHLVEEE---RQVEGNLHEPP--SYTLAQLTQV-------------L 178
               |:|.:......:.:.|:|.|::   .::.|.|....  :|.:|..::|             .
Yeast   283 IDFKNPNSKFYSKRNMIPKYLFEQQFHILRMMGPLGAKLCWNYIMAAYSRVPSLAYKEYIFELFY 347

  Fly   179 AKGSDNSVTPEFAQHLLHRQV-SKSQLYPD-RFFFSRDGRVKYYSHLQMEPEFGEALVKRIRRIP 241
            .||....||.:..:.|..|.: :|..|... ::...:...:.|..:..|..:.|..:||.:..:.
Yeast   348 GKGGIPEVTTDIFKALFSRCILAKDPLMDSLQYLNVKKLLIVYGQYDWMNKKAGMFMVKELNNLK 412

  Fly   242 -CLIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFI 299
             ||  :|:                       .:.|:....|::.|...|...:.||.|:
Yeast   413 NCL--EGA-----------------------SYLEIPSSGHNLFLDNPESFNQSIVSFL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 70/356 (20%)
Abhydrolase 47..>109 CDD:304388 21/102 (21%)
ECM18NP_010410.3 PLN02894 <112..442 CDD:215484 69/364 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.