DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and ICT1

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_013200.1 Gene:ICT1 / 850788 SGDID:S000004089 Length:394 Species:Saccharomyces cerevisiae


Alignment Length:366 Identity:73/366 - (19%)
Similarity:132/366 - (36%) Gaps:118/366 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RWY-----GNRTERPILAIHGWLDNLGTFDRLIPLLPDYI-GVLCIDLPGHG------------- 66
            :|:     .|:...|.:.|||:..:...|.|....|.|.| .:..||||.:|             
Yeast    58 QWHFHNKRANKVCTPTVLIHGYAASSMAFYRTFENLSDNIKDLYAIDLPANGASEAPALQVNKTK 122

  Fly    67 -----RSAHIQPGMHYAVND------------------YVLIIPRVMKEYGWSKVSLMGHSLGGI 108
                 |..||:..:...|.:                  :|..|.:..|:....|::::|||.||.
Yeast   123 KIKSLRFKHIEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKLRKINVVGHSFGGY 187

  Fly   109 ISFVYTSLAPDTVDMVISLDILLPLSK-----------DPKTVI---------KYLNHSLD--KH 151
            |||.|....||:::   .|.::.||..           :|.|..         :|....|:  :.
Yeast   188 ISFKYALKYPDSIE---KLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVPRF 249

  Fly   152 LVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEFAQ--------HLLHRQVSKSQLYPDR 208
            :.|.:..|           |..:..:.:|...|.::..:.:        :|||..|.|:|....:
Yeast   250 IFENQLNV-----------LKWMGPIGSKLCSNYISTAYVKVPDQIYKDYLLHSFVGKNQTVQPQ 303

  Fly   209 FFFSRDGRVKYYSHLQMEPEFGEALVKR------IRRI----PCLIIKGSKSDFVE-----ARTE 258
                   .:|.::||     |...|:.|      :|.:    |.:.:.| :.|:::     ..||
Yeast   304 -------TIKVFTHL-----FERNLIARDPIINNVRFLNPATPVMFMYG-EHDWMDKYAGYLTTE 355

  Fly   259 KAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFI 299
            .    :.:|.....:.||....|::.|...:..|..:|.|:
Yeast   356 S----MLKNKAKASYVEVPDAGHNLFLDNPQHFASSLVSFL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 71/353 (20%)
Abhydrolase 47..>109 CDD:304388 21/98 (21%)
ICT1NP_013200.1 PLN02894 <53..388 CDD:215484 71/360 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.