DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT1G77420

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_177867.1 Gene:AT1G77420 / 844079 AraportID:AT1G77420 Length:382 Species:Arabidopsis thaliana


Alignment Length:242 Identity:48/242 - (19%)
Similarity:80/242 - (33%) Gaps:87/242 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FKEVRIPAPWGHISGRWYGNRTERPILAIHGWLDNLGT-------------------FDRLIPLL 51
            ||:    ||.|..:..||...::...:....||...|.                   ||.:...:
plant    84 FKK----APSGIRTEEWYERNSKGEDIFCKSWLPKSGDEIKAAVCFCHGYGSTCTFFFDGIAKQI 144

  Fly    52 PDY-IGVLCIDLPGHGRSAHIQPGMHYAVNDYVLIIPRVMKEY----GWSKVS-----LMGHSLG 106
            ..: .||..||.||.|    :..|:|..:..:..:....::::    |.|::.     |:|.|:|
plant   145 AGFGYGVYAIDHPGFG----LSDGLHGHIPSFDDLADNAIEQFTKMKGRSELRNLPRFLLGQSMG 205

  Fly   107 GIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTL 171
            |.::.......|...|.:|.:..:..:|:|.|                           ||...|
plant   206 GAVALKIHLKEPQAWDGLILVAPMCKISEDVK---------------------------PPPLVL 243

  Fly   172 AQLTQVLAKGSDNSVTPEFAQHLLHRQVSKSQLYPDR----FFFSRD 214
            ..|.                  |:.....|::|:|.|    ||| ||
plant   244 KTLI------------------LMSTLFPKAKLFPKRDLSDFFF-RD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 41/219 (19%)
Abhydrolase 47..>109 CDD:304388 16/71 (23%)
AT1G77420NP_177867.1 PLN02385 39..382 CDD:215216 48/242 (20%)
Hydrolase_4 117..361 CDD:288960 38/205 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.