DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT1G72620

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_177406.2 Gene:AT1G72620 / 843594 AraportID:AT1G72620 Length:335 Species:Arabidopsis thaliana


Alignment Length:216 Identity:45/216 - (20%)
Similarity:75/216 - (34%) Gaps:62/216 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GRWYGNRTERPI----LAIHGWLDNLGTFDRLIPLLPDYIGVLCIDLPGHG-----RSAHIQPGM 75
            |:.|...|:|.|    .:|.|.|..||..|          |.|.:....:|     |.|.|.|.|
plant   121 GKSYSRNTDRTIEFQARSIVGGLKRLGCGD----------GDLSVYSISYGGFVAYRIAKIWPEM 175

  Fly    76 HYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTV 140
               :...|::...|..........:..|  ||.:|.:.....|..:.:::.:.:        .|.
plant   176 ---IEKLVIVSSGVGFTQQQKMTEMKKH--GGDVSEILVPSNPRDLRLLVKVSM--------NTG 227

  Fly   141 IKYLNH----------------------SLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSD 183
            |::|:.                      .|.|:|:|.|       .||..::::|.|.::....|
plant   228 IRFLDWVPDFILSQFIAVMYETNRQELVDLAKNLLERE-------EEPELFSISQRTLIVWGDKD 285

  Fly   184 NSVTPEFAQHLLHRQVSKSQL 204
            |....|..:. |.|.:..|.|
plant   286 NVFPLEHGRR-LQRHLPNSSL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 42/207 (20%)
Abhydrolase 47..>109 CDD:304388 13/66 (20%)
AT1G72620NP_177406.2 MhpC 59..334 CDD:223669 45/216 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.