DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT1G17430

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_564022.1 Gene:AT1G17430 / 838315 AraportID:AT1G17430 Length:332 Species:Arabidopsis thaliana


Alignment Length:223 Identity:44/223 - (19%)
Similarity:76/223 - (34%) Gaps:57/223 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYLNHSLDKHLVEEERQ 158
            |...:|:...|.||.:::....:.|..|:.::.:...:..::..||.      .|.||       
plant   147 GGGGISIYSISYGGFVAYKMAEIWPAMVEKLVIVSSGVGFTQQQKTA------ELKKH------- 198

  Fly   159 VEGNLHEPPSYTLAQLTQVLAKGSDNS-----VTPEFAQHLLHRQVSKSQLY----PDRFFFSRD 214
                                  |.|.|     .||...:.|:...::....:    || ||.|:.
plant   199 ----------------------GGDCSKILVPKTPMDLRLLIKISMNTGLTFVDWVPD-FFLSQF 240

  Fly   215 GRVKYYSHLQMEPEFGEALVKRIR--RIP-----CLIIKGSKSDFVEARTEKAVAILRQ-NNPHF 271
            ..|.|..:.|...|..:.|::|..  .:|     .||:.|.|.....  .|.|..:.|. .:...
plant   241 IAVMYEKNRQELLELAKNLLEREEEPELPVISQKTLIVWGDKDKVFP--LEHAYRLQRHLQSSRL 303

  Fly   272 EFYEVEGGTHHVHLHAAEECARYIVPFI 299
            |..:..|  |.|::.|......:|..|:
plant   304 EIIKETG--HAVNIEAPTTLNNFITSFV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 44/223 (20%)
Abhydrolase 47..>109 CDD:304388 5/14 (36%)
AT1G17430NP_564022.1 MhpC 78..328 CDD:223669 43/220 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.