DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT5G39220

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_198738.2 Gene:AT5G39220 / 833918 AraportID:AT5G39220 Length:330 Species:Arabidopsis thaliana


Alignment Length:319 Identity:71/319 - (22%)
Similarity:112/319 - (35%) Gaps:92/319 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRIPAP--WGHISGRWYGN--------RTERPILAIHGWLDNLGTFDRLIPLLPD-YIGVLCIDL 62
            ||||.|  .|:..|....:        ..:.|::.:|.:..:...:.|..|||.. .:....||:
plant    52 VRIPVPLQMGNFRGSVMSSCIKPLVQLHDKSPVVLLHCFDSSCLEWRRTYPLLEQACLETWAIDV 116

  Fly    63 PGHGRS-AHIQPGMHYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVIS 126
            .|.|.| ....|....|...:.|.  .:.|.|....:.|:|.|||..::..:|:..|:.||.::.
plant   117 LGWGFSDLEKLPPCDAASKRHHLF--ELWKTYIKRPMILVGPSLGATVAVDFTATYPEAVDKLVL 179

  Fly   127 LDILL------PLSKDPKTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNS 185
            ::...      .|.:.||: |.|....|.|                 |:.|..|..|||      
plant   180 INANAYSEGTGRLKELPKS-IAYAGVKLLK-----------------SFPLRLLANVLA------ 220

  Fly   186 VTPEFAQHLLHRQVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGEALV-----------KRIRR 239
                |....|...:..:.:          ||:    |.|| |.:.:|:|           ..|:.
plant   221 ----FCSSPLSENIDWTNI----------GRL----HCQM-PWWEDAMVDFMISGGYNVASHIKH 266

  Fly   240 I--PCLIIKGSKSDFVEAR------TEKAVAILRQ-----NNPHFEFYEVEGGTHHVHL 285
            |  ..|::.......|..:      .|.|.|:||:     :.||     ||...|.|.|
plant   267 IDHKTLVVCSENDQIVSNQLSVKLLCELANAVLREVPDSGHLPH-----VENPKHIVKL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 64/289 (22%)
Abhydrolase 47..>109 CDD:304388 18/63 (29%)
AT5G39220NP_198738.2 MhpC 79..327 CDD:223669 64/292 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.