DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT5G17720

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_197274.1 Gene:AT5G17720 / 831639 AraportID:AT5G17720 Length:443 Species:Arabidopsis thaliana


Alignment Length:276 Identity:56/276 - (20%)
Similarity:96/276 - (34%) Gaps:79/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ISGRWYGNRTERPILAIHGWLDNLGTF-DRLIPLLPD-----YIGVLCIDLPGHGRSAHIQP-GM 75
            ||.....|:....::.:||:|.:...: :.:...||:     ......|||.|.|.|.  :| ..
plant   150 ISDLSISNKPVENVIFVHGFLASSSFWTNTVFKYLPETTEGTNYRFFAIDLLGFGDSP--KPRAS 212

  Fly    76 HYAVNDYVLIIPR-VMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKT 139
            .|::.::|.:|.: |:.....:...::.||:|.||.....:...|:|..|.              
plant   213 QYSLKEHVEMIEKSVILPNNLTSFHVVAHSMGCIIGIALAAKFSDSVKSVA-------------- 263

  Fly   140 VIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHLLHRQVSKSQL 204
                                   |..||.:       ..:||..:....:.        |:|.:|
plant   264 -----------------------LVAPPYF-------ADSKGGASCAALDV--------VAKKKL 290

  Fly   205 YPDRFFFSRDGRVKYYSHLQMEPEFGEALV-KRIRRIPCLIIKGSKSDFVEARTEKAVAILRQNN 268
            :|...||:  ..:.:|.|:..    |..|| .|..|....|||     .|..|.:...||:    
plant   291 WPPASFFT--AMMCWYEHIGR----GVCLVFCRHHRTWERIIK-----IVTWRRKLPTAIM---- 340

  Fly   269 PHFEFYEVEGGTHHVH 284
             .|..:..:.|.|.:|
plant   341 -DFTKHTHQSGWHSMH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 53/265 (20%)
Abhydrolase 47..>109 CDD:304388 16/68 (24%)
AT5G17720NP_197274.1 PLN03087 13..437 CDD:215567 56/276 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.