DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT4G39955

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_568075.1 Gene:AT4G39955 / 830156 AraportID:AT4G39955 Length:328 Species:Arabidopsis thaliana


Alignment Length:294 Identity:58/294 - (19%)
Similarity:104/294 - (35%) Gaps:91/294 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGHISGRWYGNRTERPILAIHG--------WLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAH 70
            |..||       .|:..:|.:||        | |..  .||.||....|:.    ||...|.|..
plant    42 PLTHI-------HTKPTLLLLHGIGANAMWQW-DRF--IDRFIPRFNVYVP----DLIFFGDSYT 92

  Fly    71 IQPGMHYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVI---------- 125
            .:|....:..  ...:.:.|..||...:::.|.|.||.:::...:...:.||.|:          
plant    93 TRPDRSESFQ--ATCVMKAMDAYGVRTMTVAGLSYGGFVAYSLAAQFKERVDRVVLICAGVALEE 155

  Fly   126 ---------------SLDILLPLS-------------KDPKTV-----IKYLNHSLDKHLVEEER 157
                           :..:|.|.|             |.|..:     :.|: |.:.|..::|.:
plant   156 KDSEDGMFKVKSPEEAAAVLFPQSPSMLRRLLQLSFYKPPIWIPSCFAMDYI-HVMCKDYLQERK 219

  Fly   158 QVEGNLHEPPSY-TLAQLTQ--VLAKGSDNSVTPEFAQHLLHRQV--SKSQLYPDRFFFSRDGRV 217
            ::...||:...: .|.::||  ::..|.::.|.|....|.|.|.:  .::||    ....:.|..
plant   220 ELVEALHKGRRFANLPKITQPTLMIWGEEDQVFPVELAHRLKRYLGEDRAQL----VLLKKTGHA 280

  Fly   218 -------KYYSHLQ-------MEPEFGEALVKRI 237
                   :.|.|::       |.|:..:...||:
plant   281 INEEKPKEMYKHMKSFLCTDAMIPQNHQINAKRL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 54/279 (19%)
Abhydrolase 47..>109 CDD:304388 15/61 (25%)
AT4G39955NP_568075.1 MhpC 47..297 CDD:223669 51/263 (19%)
Abhydrolase_5 51..280 CDD:289465 48/242 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.