DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT4G02340

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_567228.1 Gene:AT4G02340 / 828063 AraportID:AT4G02340 Length:324 Species:Arabidopsis thaliana


Alignment Length:312 Identity:66/312 - (21%)
Similarity:114/312 - (36%) Gaps:60/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILAIHG-------WLDNLGTFDRLIPLLPDYIGVLCI--DLPGHGRSAHIQPGMHYAVNDYVLII 86
            ||.:||       |...|.:|..|        |...|  ||.|:|.|........|.:...|..:
plant    27 ILFVHGFPDLWYSWRHQLVSFAAL--------GYRAIAPDLRGYGDSDAPPSRESYTILHIVGDL 83

  Fly    87 PRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILL-PLSKDPKTVIKYLNHSLDK 150
            ..::...|..:|.|:||..|.|:::....:.||.|:.:::..::. |.:...|.|..:.....|.
plant    84 VGLLDSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVNALVNTSVVFNPRNPSVKPVDAFRALFGDD 148

  Fly   151 HLV---EEERQVEGNLHEPPSYTLAQLTQVLAKGS------DNSV-------TPEFAQHLLHRQV 199
            :.:   :|..::|.:..:..:..|  :|:.....:      ..||       .|.....|..:.|
plant   149 YYICRFQEPGEIEEDFAQVDTKKL--ITRFFTSRNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDV 211

  Fly   200 SKSQLYPDRFF---FSRDGRVKYYSHLQMEPEFGEALVKRIRRIPCLI----------IKGSKSD 251
               :.|.|:|.   |:  |.:.||..|.:..|..........::|...          |.|:|..
plant   212 ---RFYGDKFSQKGFT--GGLNYYRALNLSWELTAPWTGLQIKVPVKFIVGDLDITYNIPGTKEY 271

  Fly   252 FVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFIRHHR 303
            ..|...:|.|..|:      |...:||..|.:|....:|...:|..|.:..|
plant   272 IHEGGLKKHVPFLQ------EVVVMEGVGHFLHQEKPDEVTDHIYGFFKKFR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 65/309 (21%)
Abhydrolase 47..>109 CDD:304388 16/63 (25%)
AT4G02340NP_567228.1 MhpC 5..315 CDD:223669 65/308 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.