DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT4G15960

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_193331.6 Gene:AT4G15960 / 827279 AraportID:AT4G15960 Length:375 Species:Arabidopsis thaliana


Alignment Length:373 Identity:70/373 - (18%)
Similarity:117/373 - (31%) Gaps:141/373 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSDFKE---VRI-------PAPWGHISGRWYGNRTERP------------------------- 30
            :|||.|:.   :|:       |.|..|.| ....|:|:||                         
plant     8 LSLSRFRHHFPLRLRRFLGENPNPTTHFS-TLPDNQTKRPEKSRLDGVEHKTLKVNGINMHVAEK 71

  Fly    31 ----------ILAIHG-------W------LDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQ 72
                      ||.:||       |      |.:|| :..:.|           ||.|:|.:...:
plant    72 PGSGSGEDPIILFLHGFPELWYTWRHQMVALSSLG-YRTIAP-----------DLRGYGDTEAPE 124

  Fly    73 PGMHYAV----NDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPL 133
            ....|..    .|.|.:|..|..  |...||::||..|.:|::......|:.|..::::.:|...
plant   125 KVEDYTYLNVDGDVVALIDAVTG--GDKAVSVVGHDWGAMIAWQLCQYRPEKVKALVNMSVLFSP 187

  Fly   134 SKDPKTVIKYLNHSL-DKHLV---EEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHL 194
            ....:..:..|.|.. |.:.|   ::..::|              |:....|::| |..||   |
plant   188 RNPVRVPVPTLRHVFGDDYYVCRFQKAGEIE--------------TEFKKLGTEN-VLKEF---L 234

  Fly   195 LHRQVSKSQLYPDRFFFSRD----------------------------GRVKYYSHLQMEPEFGE 231
            .::......|..|::|...:                            |.:.||.::....|...
plant   235 TYKTPGPLNLPKDKYFKRSENAASALPLWLTQEDLDYYVTKYENKGFTGPINYYRNIDRNWELTA 299

  Fly   232 ALVKRIRRIPCLIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEGG 279
            .......|:|...|.|.:.             |..|.|..:.| :.||
plant   300 PWTGAKIRVPVKFIIGDQD-------------LTYNFPGAKEY-INGG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 59/335 (18%)
Abhydrolase 47..>109 CDD:304388 16/65 (25%)
AT4G15960NP_193331.6 MhpC 55..371 CDD:223669 57/325 (18%)
Abhydrolase 64..372 CDD:304388 57/316 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.