DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT4G15955

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001154238.1 Gene:AT4G15955 / 827278 AraportID:AT4G15955 Length:304 Species:Arabidopsis thaliana


Alignment Length:328 Identity:68/328 - (20%)
Similarity:115/328 - (35%) Gaps:114/328 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNRTERP--ILAIHG-------W------LDNLGTFDRLIPLLPDYIGVLCIDLPGHG-----RS 68
            ||...||  ||.:||       |      |.:|| :..:.|           ||.|:|     .|
plant    28 GNGAIRPPVILFLHGFPELWYTWRHQMVALSSLG-YRTIAP-----------DLRGYGDTDAPES 80

  Fly    69 AHIQPGMHYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPL 133
            ......:| .|.|.:.:|..|:.:.  .||.::||..|.||::......||.|..::::.::.  
plant    81 VDAYTSLH-VVGDLIGLIDAVVGDR--EKVFVVGHDWGAIIAWHLCLFRPDRVKALVNMSVVF-- 140

  Fly   134 SKDPKTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLA------------QLTQVL-------- 178
              ||                       .|....|:.|..            ||.::|        
plant   141 --DP-----------------------WNPKRKPTSTFKAFYGDDYYICRFQLLEILIKIHVCIV 180

  Fly   179 AKGSDNSVTPEFAQHLLHRQVSKSQLYPDRFFFSR------DGRVKYYSHLQMEPEFGEALVKRI 237
            .|..|:||:       |...::.|.:   :::.|:      .|.|.||.::....|...:|....
plant   181 GKRYDDSVS-------LPSWLTDSDV---KYYVSKYEKNGFTGPVNYYRNMDRTWELMGSLSNAK 235

  Fly   238 RRIPCLI----------IKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECA 292
            .::|...          |.|||....:.|.:..|.:|.      |...::|..|.:|....:|.:
plant   236 VKVPVKFIIGDQDLTYHIPGSKKYIHDGRFKSHVPLLD------EVVVIKGVGHFIHEERPDEIS 294

  Fly   293 RYI 295
            ::|
plant   295 KHI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 66/323 (20%)
Abhydrolase 47..>109 CDD:304388 16/66 (24%)
AT4G15955NP_001154238.1 MhpC 7..301 CDD:223669 68/328 (21%)
Abhydrolase 35..>134 CDD:304388 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.