DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT3G51000

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_190669.1 Gene:AT3G51000 / 824264 AraportID:AT3G51000 Length:323 Species:Arabidopsis thaliana


Alignment Length:325 Identity:67/325 - (20%)
Similarity:130/325 - (40%) Gaps:48/325 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KEVRIPAPWGHISGRWYGNRTERPILAIHGWLDNLGTFDRLIPLLPDY-IGVLCIDLPGHGRSAH 70
            |:::....|.:::.:  |:.....:|.:||:.:...::...|..|..: ..|:..||.|:|.|..
plant     8 KKIKTNGIWLNVAEK--GDEEGPLVLLLHGFPETWYSWRHQIDFLSSHGYHVVAPDLRGYGDSDS 70

  Fly    71 IQPGMHYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLP-LS 134
            :.....|.|:..|..:..::..||.::..:.||..|.||.:......||.|...|||.:  | ..
plant    71 LPSHESYTVSHLVADVIGLLDHYGTTQAFVAGHDWGAIIGWCLCLFRPDRVKGFISLSV--PYFP 133

  Fly   135 KDPK----TVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHLL 195
            :|||    ...|.....|.....::..:.|....:....::.:...::.: :|..|.|...:.:.
plant   134 RDPKLKPSDFFKIFGDGLYITQFQKPGRAEAAFAKHDCLSVMKKFLLITR-TDYLVAPPDTEIID 197

  Fly   196 HRQVSKS----------QLYPDRFFFSR-DGRVKYYSHLQME-----PEFGEALVKRIRRIPCLI 244
            |.::..:          |:|.::|..|. .|.:.||..:.|.     |.....:|     :|...
plant   198 HLEIPSTIPDWITEEEIQVYAEKFQRSGFTGPLNYYRSMDMNWEILAPWQDSKIV-----VPTKF 257

  Fly   245 IKGSKS----------DFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFI 299
            |.|.|.          ::|:....|.|.      |:.|...:|||.|.:....:|:.::.|:.|:
plant   258 IAGDKDIGYEGPNGTMEYVKGEVFKIVV------PNLEIVVIEGGHHFIQQEKSEQVSQEILSFL 316

  Fly   300  299
            plant   317  316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 64/303 (21%)
Abhydrolase 47..>109 CDD:304388 16/62 (26%)
AT3G51000NP_190669.1 MhpC 10..319 CDD:223669 66/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.