DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT3G05600

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_187211.1 Gene:AT3G05600 / 819726 AraportID:AT3G05600 Length:331 Species:Arabidopsis thaliana


Alignment Length:345 Identity:76/345 - (22%)
Similarity:126/345 - (36%) Gaps:74/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFKEVRIPAPWGHISGRWYGNRTERPILAIHGWLDNLGTFDRLIPLLPDYIGVLCI--DLPGHGR 67
            |.:.|.:.....||:.:  |.:....:|.:||:.|...|:...|..|.. :|...:  ||.|:|.
plant     5 DHRMVSVNGITMHIAEK--GPKEGPVVLLLHGFPDLWYTWRHQISGLSS-LGYRAVAPDLRGYGD 66

  Fly    68 SAHIQPGMHY----AVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLD 128
            |...:....|    .|.|.|.::..|....  .||.|:||..|.||.:......|:.::..:.|.
plant    67 SDSPESFSEYTCLNVVGDLVALLDSVAGNQ--EKVFLVGHDWGAIIGWFLCLFRPEKINGFVCLS 129

  Fly   129 ILLPL-SKDPKT--VIKYLNHSLDKHLV---EEERQVEGNL-HEPPSYTLAQL-------TQVLA 179
            :  |. |::||.  |..:.....|.:.:   :|..::||.: ...|...|..|       ..:|.
plant   130 V--PYRSRNPKVKPVQGFKAVFGDDYYICRFQEPGKIEGEIASADPRIFLRNLFTGRTLGPPILP 192

  Fly   180 K----------GSDNSVTPE-FAQHLLHRQVSKSQLYPDRFFFSR---DGRVKYYSHLQMEPEFG 230
            |          .|:|...|| |::..|...|||         |.:   .|.:.||..:.:..|..
plant   193 KDNPFGEKPNPNSENIELPEWFSKKDLDFYVSK---------FEKAGFTGGLNYYRAMDLNWELT 248

  Fly   231 EALVKRIRRIPCLIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYI 295
            ........::|   :|....||....|          .|..:.| :.||.....:...:|    |
plant   249 APWTGAKIQVP---VKFMTGDFDMVYT----------TPGMKEY-IHGGGFAADVPTLQE----I 295

  Fly   296 V------PFIRHHRPPALTS 309
            |      .|:...:|..:|:
plant   296 VVIEDAGHFVNQEKPQEVTA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 69/312 (22%)
Abhydrolase 47..>109 CDD:304388 19/67 (28%)
AT3G05600NP_187211.1 MhpC 6..324 CDD:223669 75/344 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.