DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT2G26750

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_180243.1 Gene:AT2G26750 / 817216 AraportID:AT2G26750 Length:320 Species:Arabidopsis thaliana


Alignment Length:330 Identity:68/330 - (20%)
Similarity:107/330 - (32%) Gaps:100/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WYGNRTERPILAIHGWLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRS---AHIQPGMHY-AVNDY 82
            ||..|.:...||..|:                  ..:..||.|:|.|   |.|.....: .|.|.
plant    36 WYSWRHQISGLAARGY------------------RAVAPDLRGYGDSDAPAEISSFTCFNIVGDL 82

  Fly    83 VLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLS---KDPKTVIKYL 144
            |.:|..::||.  .||.::||..|.:|::......||.|..:::|.:  |||   .||..     
plant    83 VAVISTLIKED--KKVFVVGHDWGALIAWYLCLFRPDKVKALVNLSV--PLSFWPTDPSV----- 138

  Fly   145 NHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHLLHRQVSKSQLY---- 205
                  ..|:..|.|.||     .|.:.:..:|      ..:..|.|:....|.:.:...|    
plant   139 ------KPVDRMRAVYGN-----DYYVCRFQEV------GDIEAEIAEVGTERVMKRLLTYRTPG 186

  Fly   206 -----PDRFFFSRDGR----------------------------VKYYSHLQMEPEFGEALVKRI 237
                 .|:.|:...|.                            |.||.:.....|.....|...
plant   187 PLIIPKDKSFWGSKGETIPLPSWLTEEDVAYFVSKFKEKGFCGPVNYYRNFNRNNELLGPWVGSK 251

  Fly   238 RRIPCLIIKGSKSDFVEARTEKAVAILRQNNPHF--------EFYEVEGGTHHVHLHAAEECARY 294
            .::|...:.| :.|.|.........|   :.|.|        |...:||..|.::....:|..:.
plant   252 IQVPTKFVIG-ELDLVYYMPGVKEYI---HGPQFKEDVPLIEEPVVMEGVAHFLNQEKPQEILQI 312

  Fly   295 IVPFI 299
            |:.||
plant   313 ILDFI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 65/323 (20%)
Abhydrolase 47..>109 CDD:304388 18/65 (28%)
AT2G26750NP_180243.1 MhpC 2..317 CDD:223669 66/328 (20%)
Abhydrolase 8..>123 CDD:304388 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.