DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and AT2G18360

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_565437.1 Gene:AT2G18360 / 816351 AraportID:AT2G18360 Length:313 Species:Arabidopsis thaliana


Alignment Length:267 Identity:58/267 - (21%)
Similarity:96/267 - (35%) Gaps:80/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TERPILAIHGW-LDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQPGMHYAVNDYVLIIPRVM 90
            |:..:|.|||: .:.:.|:...:..|.....|...||...|.|.........|...:.|:  :.:
plant    61 TKPVLLFIHGFAAEGIVTWQFQVGSLAKKYSVYIPDLLFFGGSYSDNADRSPAFQAHCLV--KSL 123

  Fly    91 KEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVI------------------------SLDILL 131
            :..|..|.:|:|.|.||:::|......|:.|..::                        |.|:||
plant   124 RILGIEKFTLVGFSYGGMVAFKIAEEYPEMVQAMVVSGSILAMTDTISESNLNQLGFKSSADLLL 188

  Fly   132 PLS-KDPKTVIKYLNHS-------LDKHLVE------EERQVEGNLHEPPSYTLAQLTQVLAKGS 182
            |.| |..||:.....|.       |.|..:|      :||              |:|.:.|...:
plant   189 PTSVKGLKTLFTLAVHKPMWFPKRLFKDFIEVMITNRKER--------------AELLEALVISN 239

  Fly   183 DNSVTPEFAQ--HLLHRQVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGE-ALVKRIRRI---- 240
            .:...|.|.|  |||..:  ..|::...|..|            |:.:.|| |.::.|::.    
plant   240 KDVTIPRFQQKIHLLWGE--SDQIFNLEFAKS------------MKEQLGENATMESIKKAGHLA 290

  Fly   241 ----PCL 243
                ||:
plant   291 HLERPCV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 57/265 (22%)
Abhydrolase 47..>109 CDD:304388 15/61 (25%)
AT2G18360NP_565437.1 MhpC 52..309 CDD:223669 58/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.