DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and abhd6a

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_001339480.1 Gene:abhd6a / 799085 ZFINID:ZDB-GENE-090925-1 Length:339 Species:Danio rerio


Alignment Length:286 Identity:58/286 - (20%)
Similarity:116/286 - (40%) Gaps:37/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNRTERP-ILAIHGWLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQPGMHYAVNDYVLIIP 87
            ||...|| :|.:||:..:...:..::..||..:.::|:|:|||..::... .:.|::...|..|.
Zfish    66 GNPGFRPSVLMLHGFSAHKDMWLGVVKFLPKNVHLICVDMPGHEGTSRTS-AVDYSIEGQVKRIN 129

  Fly    88 RVMKEYGWSK--VSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYLNHSLDK 150
            :.:|..|.:|  ..|:|.|:||.::.||.:..|..   :..:.::.|..         |.:..:.
Zfish   130 QFVKSIGLNKKPFHLIGTSMGGNVAGVYAARHPSE---LCGVTLICPAG---------LQYPTES 182

  Fly   151 HLVEEERQVEGNLHEP-----PSYTLAQLTQVLAKGS--DNSVTPEFAQHLLHRQVSKSQLYPDR 208
            ..||..|::|......     || |..|:.::|...|  ...:..:..|.|:..::..:..|.:.
Zfish   183 KFVERLRELEKTQDRDGIPLIPS-TPEQMEEMLKLCSYVRFKIPKQILQGLVDVRIPNNDFYHEC 246

  Fly   209 FFFSRDGRVKYYSHLQMEPEFGEALVKRIRRIPCLIIKGSKSDFVEARTEKAVAILRQNNPHFEF 273
            |......:.::..|..|          .:...|..:|.|.....::.   ...::|....|..:.
Zfish   247 FMELVGEKSRHSLHENM----------HLISTPLQVIWGKNDQVLDV---SGASVLSGAVPGCQV 298

  Fly   274 YEVEGGTHHVHLHAAEECARYIVPFI 299
            :.::...|.|.|....:.|:.|..||
Zfish   299 HLLDNCGHSVVLERPRKSAQLITDFI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 56/281 (20%)
Abhydrolase 47..>109 CDD:304388 18/63 (29%)
abhd6aXP_001339480.1 MhpC 52..324 CDD:223669 56/284 (20%)
Abhydrolase 71..>168 CDD:304388 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.