DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and ABHD8

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_078803.4 Gene:ABHD8 / 79575 HGNCID:23759 Length:439 Species:Homo sapiens


Alignment Length:314 Identity:70/314 - (22%)
Similarity:111/314 - (35%) Gaps:92/314 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNRTERPILAIHG-------WLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQPGMHYAVND 81
            |.:.:..:..|||       |.:.|..|.||     .| .|:..||.|||.|:..|....|....
Human   171 GAQADVVLFFIHGVGGSLAIWKEQLDFFVRL-----GY-EVVAPDLAGHGASSAPQVAAAYTFYA 229

  Fly    82 YVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLA---PDTVDMVISLDILLPLSKDPK----- 138
            ....:..:.|.|...:..|:|||.|  :||. |.||   ||.|..||.::...|.:.:|.     
Human   230 LAEDMRAIFKRYAKKRNVLIGHSYG--VSFC-TFLAHEYPDLVHKVIMINGGGPTALEPSFCSIF 291

  Fly   139 ----TVIKYLNHSLDKHLVE--------EERQV--EGNLHEPPSYTLAQLTQVLAKGSDNSVTPE 189
                .|:..|:..|....::        :|:|:  |||.....|:.|                  
Human   292 NMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVL------------------ 338

  Fly   190 FAQHLLHRQVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGEALVKRIRRIPCLIIKGSKSDFVE 254
                   |.:...|.:|       :|...|::.|               .:|.|::.|....||.
Human   339 -------RAMMSGQYWP-------EGDEVYHAEL---------------TVPVLLVHGMHDKFVP 374

  Fly   255 ARTEKAVA-ILRQNNPHFEFYE-VEGGTHHVHLHAAEECARYIVPFIRHHRPPA 306
            ...::.:| ||.     ..|.: ::.|:|.|.|...|.....:..|:.....|:
Human   375 VEEDQRMAEILL-----LAFLKLIDEGSHMVMLECPETVNTLLHEFLLWEPEPS 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 68/303 (22%)
Abhydrolase 47..>109 CDD:304388 18/61 (30%)
ABHD8NP_078803.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..156
MhpC 156..416 CDD:223669 68/305 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.