DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and Serhl

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_075964.1 Gene:Serhl / 68607 MGIID:1890404 Length:311 Species:Mus musculus


Alignment Length:326 Identity:90/326 - (27%)
Similarity:146/326 - (44%) Gaps:63/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVRIPAPWGHISGRWYGNRTERPILAIHGWLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQ 72
            |:::..|||||:.:.:|::...|:|.:||||||..:|||||||||.....:.:|..|||.|:|..
Mouse     6 ELKLAVPWGHIALKVWGSQKNPPVLCLHGWLDNANSFDRLIPLLPQDFCYMAMDFGGHGLSSHYN 70

  Fly    73 PGMHYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPL---S 134
            ||:.|...::|..:.||...:.|::.:|:|||.||.:...:..:.|:.||.:|.|| ..|.   |
Mouse    71 PGLPYYQQNFVSEVRRVATAFKWNQFTLLGHSFGGCVGGTFACMFPEMVDKLILLD-STPFFLDS 134

  Fly   135 KDPKTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPE-----FAQHL 194
            .:.:.::.|...:     :|...|||.:                .|.|..:|:||     |..:.
Mouse   135 NEMENILTYRRRN-----IEHTLQVEAS----------------QKKSLRAVSPEEMLQGFLNNN 178

  Fly   195 LHRQVSKSQLYPDR--------FFFSRDGRVKYYSHLQMEPEFG------EALVKRIRRIPC--L 243
            .|......:|...|        ...:||.|:.:       ||..      |..|...:.:..  |
Mouse   179 SHLDKDCGELILQRGTTKVDAGLVLNRDRRISW-------PENSFDFVSKEMFVHSAKSLQASVL 236

  Fly   244 IIKGSKSDFVEARTEKA--------VAILRQN-NPHFEFYEVEGGTHHVHLHAAEECARYIVPFI 299
            :||..:..:...|...|        |..||.. ...|:|.||. |.|::|::..:..|..:.||:
Mouse   237 MIKALQGYYDVRRANDADKAPMHFMVDTLRSTLKERFQFVEVP-GNHYIHMNKPQVVAGVVGPFL 300

  Fly   300 R 300
            :
Mouse   301 Q 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 83/305 (27%)
Abhydrolase 47..>109 CDD:304388 25/61 (41%)
SerhlNP_075964.1 MhpC 15..303 CDD:223669 86/317 (27%)
Abhydrolase_5 28..>129 CDD:289465 42/101 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832186
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4450
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51866
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 1 1.000 - - FOG0001238
OrthoInspector 1 1.000 - - otm42436
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4622
SonicParanoid 1 1.000 - - X774
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.900

Return to query results.
Submit another query.