DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and Abhd5

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_080455.1 Gene:Abhd5 / 67469 MGIID:1914719 Length:351 Species:Mus musculus


Alignment Length:320 Identity:68/320 - (21%)
Similarity:114/320 - (35%) Gaps:96/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNR-----------TERPILAIHGWLDNLG----TFDRLIPLLPDYIGVLCIDLPGHGRSA--HI 71
            |||           ::.|::.:||:...||    .|:.|....|.|    ..||.|.|||:  ..
Mouse    62 GNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVY----AFDLLGFGRSSRPRF 122

  Fly    72 QPGMHYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDIL-LPLSK 135
            ........|.:|..|..........|:.|:||:|||.::..|:...|..|..:|.::.. .|...
Mouse   123 DSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERP 187

  Fly   136 DPKTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTP-----------E 189
            |               |.::||.:       |.:       :.|.|:  ::||           .
Mouse   188 D---------------LADQERPI-------PVW-------IRALGA--ALTPFNPLAGLRIAGP 221

  Fly   190 FAQHLLHRQVSKSQLYPD-----RFFFSRDGRVKYYSHLQMEPEFGEALVKR------------I 237
            |...|:.|      |.||     ...|..|...:|..|..::...||...|.            :
Mouse   222 FGLSLVQR------LRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPML 280

  Fly   238 RR-------IPCLIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEE 290
            :|       ||..:|.|::| .::..:..::..||..: :.:...:.|..|:|:....||
Mouse   281 QRIGGLHPDIPVSVIFGARS-CIDGNSGTSIQSLRPKS-YVKTIAILGAGHYVYADQPEE 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 65/304 (21%)
Abhydrolase 47..>109 CDD:304388 19/63 (30%)
Abhd5NP_080455.1 PLN02894 3..347 CDD:215484 68/320 (21%)
HXXXXD motif 329..334 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.