DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and Abhd6

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001317993.1 Gene:Abhd6 / 66082 MGIID:1913332 Length:336 Species:Mus musculus


Alignment Length:317 Identity:64/317 - (20%)
Similarity:126/317 - (39%) Gaps:71/317 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WYGNRT--------------------ERP-----ILAIHGWLDNLGTFDRLIPLLPDYIGVLCID 61
            ||..||                    .||     ||.:||:..:...:..::..||..:.::|:|
Mouse    40 WYWRRTLGMQVRYAHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVD 104

  Fly    62 LPGHGRSAHIQPGMHYAVNDYVLIIPRVMKEYGW--------SKVSLMGHSLGGIISFVYTSLAP 118
            :|||       .|...:..|.:.|:.:|.:.:.:        ....|:|.|:||.::.||.:..|
Mouse   105 MPGH-------EGTTRSSLDDLSIVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYP 162

  Fly   119 DTVDMVISLDILLPLSKDPKTVIKYLNHSLDKHLVEEERQVEGN--LHEPP--SYTLAQLTQVLA 179
            ..   |.||.::.|..         |.:|.|...|:..:::|.:  :.:.|  ..|..:::::|.
Mouse   163 SD---VCSLSLVCPAG---------LQYSTDNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQ 215

  Fly   180 KGS--DNSVTPEFAQHLLHRQVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGEALVKRIRRIPC 242
            ..|  ...|..:..|.|:..::..:..|...|....:.:.:|..|..|:         :| ::|.
Mouse   216 LCSYVRFKVPQQILQGLVDVRIPHNSFYRKLFLEIVNEKSRYSLHENMD---------KI-KVPT 270

  Fly   243 LIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFI 299
            .||.|.:...::.   ....||.::..:.:...:|...|.|.:....:.|:.||.|:
Mouse   271 QIIWGKQDQVLDV---SGADILAKSISNSQVEVLENCGHSVVMERPRKTAKLIVDFL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 60/290 (21%)
Abhydrolase 47..>109 CDD:304388 16/69 (23%)
Abhd6NP_001317993.1 MhpC 51..327 CDD:223669 60/306 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.