DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and ABHD6

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_005265391.1 Gene:ABHD6 / 57406 HGNCID:21398 Length:338 Species:Homo sapiens


Alignment Length:321 Identity:67/321 - (20%)
Similarity:123/321 - (38%) Gaps:78/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WYGNRT--------------------ERP-----ILAIHGWLDNLGTFDRLIPLLPDYIGVLCID 61
            ||..||                    .||     ||.:||:..:...:..::..||..:.::|:|
Human    40 WYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVD 104

  Fly    62 LPGHGRSAHIQ------PGMHYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDT 120
            :|||..:....      .|....::.:|..:....|.:     .|:|.|:||.::.||.:..|..
Human   105 MPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPF-----HLVGTSMGGQVAGVYAAYYPSD 164

  Fly   121 VDMVISLDILLPLSKDPKTVIKYLNHSLDKHLVEEERQVEGN-----LHEPPSYTLAQLTQVLAK 180
            |.   ||.::.|..         |.:|.|...|:..::::|:     :...|| |..:::::|..
Human   165 VS---SLCLVCPAG---------LQYSTDNQFVQRLKELQGSAAVEKIPLIPS-TPEEMSEMLQL 216

  Fly   181 GS--DNSVTPEFAQHLLHRQVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGEALVKRIRRIPCL 243
            .|  ...|..:..|.|:..::..:..|...|......:.:|..|..|:         :| ::|..
Human   217 CSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMD---------KI-KVPTQ 271

  Fly   244 IIKGSKSDFV-----EARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFI 299
            ||.|.:...|     .....|::|     |...|..|..|  |.|.:....:.|:.|:.|:
Human   272 IIWGKQDQQVLDVSGADMLAKSIA-----NCQVELLENCG--HSVVMERPRKTAKLIIDFL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 63/294 (21%)
Abhydrolase 47..>109 CDD:304388 15/67 (22%)
ABHD6XP_005265391.1 MhpC 51..328 CDD:223669 63/310 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.