DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and LOC570571

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_021330474.1 Gene:LOC570571 / 570571 -ID:- Length:355 Species:Danio rerio


Alignment Length:325 Identity:67/325 - (20%)
Similarity:116/325 - (35%) Gaps:120/325 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GHISG-RWY----GNRTERPILAIHGWLDNLGTFD---RLIPLLPDYIGVLCIDLPGHGRS-AHI 71
            |..|| |::    |:..:..:|.:||:.:|...:.   :|:....|: ..:.:||.|.|.| |.:
Zfish    80 GRSSGLRFHYVTKGDHKKPLMLFLHGFPENCCRYSWRHQLLEFSGDF-HTVALDLRGCGASDAPV 143

  Fly    72 QPGMHYAVNDYVL-----IIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILL 131
            :      :.||:|     .|...:.:.|.:...|:||..||::::.:....||.|.::|.::...
Zfish   144 R------LEDYLLEALLYDIRDTVDQLGHTSCILVGHDWGGMLAWHFALERPDMVQLLIVMNAPH 202

  Fly   132 PLSKDPK-----TVIKYLNHSLDKHLVEE-----------------ERQVEGNLHEPPSYTLAQ- 173
            |.|...|     .:|..|..::..|||..                 |.|:||.|     |.|:| 
Zfish   203 PASWLGKKLFRPVIISLLFFNIVLHLVRSLFCGKNVGIRNRSRRLTESQLEGYL-----YPLSQP 262

  Fly   174 --LTQVLAKGSDNSVTPEFAQHLLHRQVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGEALVKR 236
              ||..|          .:.:.||...:                    |.|..:           
Zfish   263 GGLTAPL----------NYFRSLLSNTL--------------------YKHQDV----------- 286

  Fly   237 IRRIPCLIIKGSKSD-FVEARTEKAVAILRQNNPHFEFYEVEGGTH-----HVHLHAAEECARYI 295
              .:||::|.|...: .||.                    :.|||.     .|.:|...||:.::
Zfish   287 --AVPCMLIWGEADNILVEG--------------------MSGGTRPYVRGPVTIHTIPECSHWV 329

  Fly   296  295
            Zfish   330  329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 62/307 (20%)
Abhydrolase 47..>109 CDD:304388 18/67 (27%)
LOC570571XP_021330474.1 MhpC 82..341 CDD:223669 66/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.