DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and si:dkey-122a22.2

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_697364.4 Gene:si:dkey-122a22.2 / 568911 ZFINID:ZDB-GENE-110411-93 Length:384 Species:Danio rerio


Alignment Length:309 Identity:57/309 - (18%)
Similarity:91/309 - (29%) Gaps:133/309 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WYGNRTERPILAIHGWLDNLGTFDRLIP---------LLPDYIGVLCIDLPGHGR-SAHIQPGMH 76
            |..:.|.|.:..:|          ||:.         |:...:|.|      :|| .:||.... 
Zfish   152 WRLSTTGRMVDDLH----------RLVKAADLATPFILIGSELGTL------NGRFYSHIHDTQ- 199

  Fly    77 YAVNDYVLIIP---RVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDM-----------VISL 127
              |:|.|||.|   .|.:|..|.:             |.|:.|.|....|           :|.|
Zfish   200 --VSDLVLIDPIPEDVFEEQKWQQ-------------FWYSQLIPSLQMMQFSAAAGLSRLLIIL 249

  Fly   128 DILLPLSKDPKTVIKYLNHSLDKHLVEE--ERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEF 190
            .:|.||.:             .:|:.||  :||                                
Zfish   250 GVLKPLIQ-------------GEHISEELLQRQ-------------------------------- 269

  Fly   191 AQHLLHRQVSKSQLYPDRFFF----SRDGRVKYYSHLQMEPEF----GEALVKRIRRIPCLIIKG 247
             ::||.....:|....:.||.    |:...:..|..|..:...    ||:...::          
Zfish   270 -KYLLCNPAHQSAAVDEHFFLNESASQVSEISRYKPLSSKTSVHVITGESFDDQL---------- 323

  Fly   248 SKSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHV----------HLH 286
             .||......|.....|.::.|:....::.|...|:          |||
Zfish   324 -PSDLNRVLAELQSKFLERSYPNANRIQIHGADRHMIYKNPSSLIKHLH 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 55/302 (18%)
Abhydrolase 47..>109 CDD:304388 17/74 (23%)
si:dkey-122a22.2XP_697364.4 MhpC 77..377 CDD:223669 57/309 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.