DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and abhd4

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001017287.1 Gene:abhd4 / 550041 XenbaseID:XB-GENE-921768 Length:342 Species:Xenopus tropicalis


Alignment Length:301 Identity:64/301 - (21%)
Similarity:113/301 - (37%) Gaps:93/301 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PILAIHG-------WLDNLGTFDRLIPLLPDYIG----VLCIDLPGHGRSAHIQPGM----HYAV 79
            |::.:||       |:.||           |::.    :...||.|.|||:  :|..    ..|.
 Frog    70 PLVMVHGFGGGIGLWIQNL-----------DHLSSSRTLHAFDLLGFGRSS--RPNFPSDPEGAE 121

  Fly    80 NDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLP-----LSKDPKT 139
            ..:|..|.:..::.|...:.|:||||||.::..|:...|:.|..:|.:|   |     :..||  
 Frog   122 EQFVSSIEQWREQMGIRNMILLGHSLGGFLAASYSIKFPERVKHLILVD---PWGFPTMPTDP-- 181

  Fly   140 VIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVT-------PEFAQHLLHR 197
                                 ..:..||::..| |..||.:.:..:|.       |...|.....
 Frog   182 ---------------------SEIRSPPTWVKA-LAAVLGRSNPLAVVRAAGPWGPGLVQRFRPD 224

  Fly   198 QVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGEA---------------LVKRIRRI----PCL 243
            ...|.|.|     |..|..::|..|...:...||:               ::.||.:|    |..
 Frog   225 LKRKFQEY-----FEDDTIMEYIYHCNAQTPSGESAFKTMMERFGWAKRPMMSRINQIPKDLPIT 284

  Fly   244 IIKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVH 284
            .|.|::: :::..|.:.|...|.:: ..:...::|.:|||:
 Frog   285 FIYGAET-WIDRSTGERVKEERSDS-FVKTLAIKGASHHVY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 64/301 (21%)
Abhydrolase 47..>109 CDD:304388 19/69 (28%)
abhd4NP_001017287.1 Abhydrolase 54..>169 CDD:304388 29/111 (26%)
MhpC 68..336 CDD:223669 64/301 (21%)
Abhydrolase <141..211 CDD:304388 22/96 (23%)
DHR2_DOCK <230..>338 CDD:297424 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.