DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and ephx2

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001008642.1 Gene:ephx2 / 494099 ZFINID:ZDB-GENE-041212-70 Length:557 Species:Danio rerio


Alignment Length:326 Identity:72/326 - (22%)
Similarity:122/326 - (37%) Gaps:66/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PILAIHGWLDNLGTFDRLIPLLPDY-IGVLCIDLPGHGRSAHIQPGMHYAVNDYVLIIPRVMKEY 93
            |:|..||:.::..::...||.|.|. ..||..|:.|:|.|........|:....:|.:...:.:.
Zfish   256 PVLLCHGFPESWFSWRYQIPALADAGFRVLAPDMKGYGGSTAPPDIEEYSQEQIMLDLVTFLDKM 320

  Fly    94 GWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDI-LLPLSKDPKT----------VIKYLNHS 147
            ..::|:|:||..||::.:......|:.|..|.||:. |.|:  ||.|          :..|..:.
Zfish   321 AIAQVTLVGHDWGGVLVWNMAQFHPERVRAVASLNTPLFPV--DPNTNPMEKLMAIPIFDYQIYF 383

  Fly   148 LDKHLVEEERQVEGNLHEP--------------PSYTLAQLTQVLAKGSDNSVTPEFAQHLLHRQ 198
            ....:.|.|  :|.||...              |..:.|.:.|   :|.....:|:.........
Zfish   384 QKPGVAEAE--LEKNLKRTFKLMFISSSDTGGFPKLSPAGVCQ---RGGLFVGSPDDPPRSSMLS 443

  Fly   199 VSKSQLYPDRFFFSR-DGRVKYYSHLQMEPEFGEALVKRIRR---IPCLIIKGSKSDFVEARTEK 259
            ||..|.|.:::..|. .|.:.:|.:.:....:   :|.|.|.   :|.|::...|...:......
Zfish   444 VSALQFYTEQYSKSGFRGPLNWYRNYERNWRW---MVSRPRAKILMPALMVTAGKDPVLLPAFAT 505

  Fly   260 AVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFIRHHRPPALT----SWSLSGKEEHLS 320
            .:..|..|        :..|  |:     |||..:    .:..||..|.    ||.   ||.|..
Zfish   506 GMENLIPN--------LSRG--HI-----EECGHW----TQMERPAELNKILISWL---KETHQK 548

  Fly   321 A 321
            |
Zfish   549 A 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 63/301 (21%)
Abhydrolase 47..>109 CDD:304388 18/62 (29%)
ephx2NP_001008642.1 HAD-1A3-hyp 3..217 CDD:274054
HAD_like <155..203 CDD:304363
Abhydrolase 237..>358 CDD:304388 27/101 (27%)
Abhydrolase_1 255..531 CDD:278959 63/303 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.