DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and CG5707

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster


Alignment Length:335 Identity:159/335 - (47%)
Similarity:228/335 - (68%) Gaps:14/335 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVRIPAPWGHISGRWYGNRTERPILAIHGWLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQ 72
            :|||..|||::.|:|||||..|||||:|||||||||:|:|:||||.::|||||||||||.|:.:.
  Fly    25 DVRIDMPWGYVVGKWYGNRQVRPILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLP 89

  Fly    73 PGMHYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDP 137
            .|:.|...||:.:|.|||:||.|.|||||.||:..::.||:.||.|...||::|:||:....:.|
  Fly    90 EGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKP 154

  Fly   138 KTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHLLHRQVSKS 202
            .:.|.||..:::.::||:||.......|||:||..::.|||.||:|.||..|..:|:|.|.:|:|
  Fly   155 PSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRS 219

  Fly   203 QLYPDRFFFSRDGRVKYYSHLQMEPEFGEALVKRIRRIPCLIIKGSKSDFVEARTEKAVAILRQN 267
            ..:|.:||||||||.|||:.....|.|...|.:.|:.:|..:||||:|::::.::::.:.|||:|
  Fly   220 TKFPAKFFFSRDGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDEVIGILREN 284

  Fly   268 NPHFEFYEVEGGTHHVHLHAAEECARYIVPFIRHHRPPALTSWSLSGKEEHL------------- 319
            |||||.:||: |||||||:.|:..|..|.|||.|||||.|.:|::.|.:|.|             
  Fly   285 NPHFELHEVQ-GTHHVHLNNAQGVAAVINPFILHHRPPHLENWTVDGTDETLPEVVKEFKLAVED 348

  Fly   320 SAEEKRRQQE 329
            |...|||:::
  Fly   349 SENVKRRKRK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 133/272 (49%)
Abhydrolase 47..>109 CDD:304388 35/61 (57%)
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 133/272 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448335
Domainoid 1 1.000 47 1.000 Domainoid score I11659
eggNOG 1 0.900 - - E2759_KOG1454
Homologene 1 1.000 - - H120031
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109693at6656
OrthoFinder 1 1.000 - - FOG0001238
OrthoInspector 1 1.000 - - otm42436
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X774
1110.900

Return to query results.
Submit another query.