DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and CG5377

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_651052.1 Gene:CG5377 / 42645 FlyBaseID:FBgn0038974 Length:278 Species:Drosophila melanogaster


Alignment Length:280 Identity:64/280 - (22%)
Similarity:111/280 - (39%) Gaps:57/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERPILAIHG-----WLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQP--GMHYAVNDYVLI 85
            ||.:|.:.|     |.|.....::|..|||.:. ::..|.||:|:|...|.  |:.:...|....
  Fly    42 ERSLLLMPGALGSSWTDFRPQIEQLPKLLPGHT-IIAWDPPGYGKSVPPQRKFGLEFFREDAQAA 105

  Fly    86 IPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYLNHSLDK 150
            :. :|:.....:.|::|.|.|||.:.:......:.||.:........|:.|....:|.       
  Fly   106 VD-LMRALDRPRFSILGWSDGGITALIVAGRHAEAVDRLAIWGAGAYLNADEVKALKN------- 162

  Fly   151 HLVEEERQVEGNLHEPPS--YTLAQLTQVLAKGSDNSVTPEFAQHLLHRQVSKSQLYPDRFFFSR 213
              :.:..:....:.||..  |.:.:..|:.|:..|.:..                     |:..|
  Fly   163 --IRDVAKWSPRMREPMEKVYGVERFPQLWAEWVDAACA---------------------FYDQR 204

  Fly   214 DGRVKYYSHLQMEPEFGEALVKRIRRIPCLIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEG 278
            ||            :|....|::| :||..|:.|.|...:.|   :.:..||:..||.|:||...
  Fly   205 DG------------DFCRTEVEKI-KIPTFILHGKKDPMIAA---EHIPWLRERLPHAEYYEFPE 253

  Fly   279 GTHHVHLHAAEECARYIVPF 298
            |.|::||..|||..:.:..|
  Fly   254 GKHNIHLRYAEEFNKLVADF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 63/279 (23%)
Abhydrolase 47..>109 CDD:304388 18/63 (29%)
CG5377NP_651052.1 MhpC 26..274 CDD:223669 64/280 (23%)
Abhydrolase_5 45..257 CDD:289465 55/259 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.