DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and MEST

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_002393.2 Gene:MEST / 4232 HGNCID:7028 Length:335 Species:Homo sapiens


Alignment Length:243 Identity:51/243 - (20%)
Similarity:92/243 - (37%) Gaps:69/243 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VLCIDLPGHGRSAHIQPGMHYAVNDYVLIIPRVMKEYGWS--KVSLMGHSLGGIIS----FVYTS 115
            |:.:|..|.|.|...:| .||::.:...|:..:::..|..  :::|:.|..|.|::    :.|..
Human    99 VIALDFLGFGFSDKPRP-HHYSIFEQASIVEALLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQ 162

  Fly   116 LAPDTV---DMVISLDILLPLSKDPKTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQ- 176
            .....:   .:.:|...:.|.:..|..:.|.|.              :|.:..|   .|.:|.. 
Human   163 NRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLK--------------DGGVLSP---ILTRLMNF 210

  Fly   177 -VLAKGSDNSVTPEFAQHLLHRQVSKSQLYPDRF--FFSRDGRVKYYSHLQMEPEFGEALVKRIR 238
             |.::|    :||.|..   :.:.|:|:|: |.:  ..:.||.:...|.||...:     .|:.|
Human   211 FVFSRG----LTPVFGP---YTRPSESELW-DMWAGIRNNDGNLVIDSLLQYINQ-----RKKFR 262

  Fly   239 R----------IPCLIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEV 276
            |          ||...|.|.               |...||:.||.|:
Human   263 RRWVGALASVTIPIHFIYGP---------------LDPVNPYPEFLEL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 51/243 (21%)
Abhydrolase 47..>109 CDD:304388 13/53 (25%)
MESTNP_002393.2 MhpC 47..321 CDD:223669 51/243 (21%)
RVIALD 98..103 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.