DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and CG14717

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster


Alignment Length:288 Identity:63/288 - (21%)
Similarity:114/288 - (39%) Gaps:54/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PILAIHGWLDNLGTFDRLIPLLPDYIG---VLCIDLPGHGRSAHI--QPGMHYAVNDYVLIIPRV 89
            ||:.:|....:|.:: |.:.:....:|   |:.:|...||.|.:|  ...||.|.:     :..:
  Fly    47 PIVVMHDLNLSLESW-RQVAVNLSQVGLRQVITVDARNHGLSPYITGHSPMHLAAD-----VEAL 105

  Fly    90 MKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYLNHSLDKHLVE 154
            |.....:|:..:||.:||..........|..|:.||.:||    :..|.....||...:.:.:::
  Fly   106 MSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDI----TPAPVPSNFYLTRQVFEMMLQ 166

  Fly   155 EERQVEGN--LHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHLLHRQVSKSQLYPDRFF------- 210
            ....:..|  |.|..::.|.....|:...|:           |.|.:...:...|..|       
  Fly   167 VAPSIPSNLSLSEGRTFILPLFQDVVHDASE-----------LRRIIYNLRKMQDNTFGWAVNPQ 220

  Fly   211 --FSRDGR--VKYYSHL-QMEPEFGEALVKRIRRIPCLIIKGSKSDFVEARTEKAVAILRQNNPH 270
              .|..|.  :.|.:.| .:.|..||.          |:|.||:|:||   |..::|::::..|:
  Fly   221 AVLSSWGEMMINYEATLGGLRPYMGEV----------LLIAGSQSEFV---TTTSIAVMQRYFPN 272

  Fly   271 FEFYEVEGGTHHVHLHAAEECARYIVPF 298
            .....::.| |.|:....|:....:|.|
  Fly   273 TVVQILDAG-HCVYEDQPEQFVELVVEF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 63/288 (22%)
Abhydrolase 47..>109 CDD:304388 16/66 (24%)
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 62/286 (22%)
Abhydrolase_5 47..>165 CDD:289465 30/127 (24%)
Abhydrolase <249..301 CDD:304388 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.