DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and abhd14b

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_956661.1 Gene:abhd14b / 393338 ZFINID:ZDB-GENE-040426-1342 Length:213 Species:Danio rerio


Alignment Length:168 Identity:37/168 - (22%)
Similarity:69/168 - (41%) Gaps:31/168 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILAIHG-------WLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRS-AHIQPGMHYAVNDY--VLI 85
            :|.:||       | ..:||.:.|  ....| ..|.|||||.|:| |.:.|.   ||.:.  .:.
Zfish    37 VLLLHGIRFSSKNW-QKIGTLETL--AAAGY-RALAIDLPGLGQSKAAVAPA---AVGELAPAVF 94

  Fly    86 IPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYLNHSLDK 150
            :.:|.:......|.::..||.|:.|..:.....:.:...|.   :.|:..:..|..:|.:.....
Zfish    95 LRQVCEGLQTGPVVIISPSLSGMYSLPFLFQHSELLKAYIP---VAPICTEKFTAEQYGSIQTPA 156

  Fly   151 HLVEEERQVE------GNLHEPPSYTLAQLTQVLAKGS 182
            .:|..::..:      .||.:.|::.:     |:.||:
Zfish   157 LIVYGDQDTQLGEVSLNNLSQLPNHRV-----VVMKGA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 37/168 (22%)
Abhydrolase 47..>109 CDD:304388 19/64 (30%)
abhd14bNP_956661.1 MhpC 23..212 CDD:223669 37/168 (22%)
Abhydrolase_5 37..191 CDD:289465 37/168 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.