DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and Ephx3

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001102458.1 Gene:Ephx3 / 366836 RGDID:1307206 Length:415 Species:Rattus norvegicus


Alignment Length:290 Identity:60/290 - (20%)
Similarity:116/290 - (40%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILAIHGWLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQPGMHYAVNDYVLIIPRVMKEYGW 95
            :|.:||:.:|..::...:.....:..|:.:||.|:..|...:....|.|:..:..|..::...|:
  Rat   155 MLFLHGFPENWFSWRYQLREFQSHFHVVAVDLRGYSPSDAPKDVDCYTVDLLLTDIKDIILGLGY 219

  Fly    96 SKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYLNHSLDKHLVEEERQVE 160
            ||..|:.|..|..:::.::...|..||.:|      .:|..|.:|.:..:   .:|:        
  Rat   220 SKCILVSHDWGAALAWDFSVYFPSLVDRMI------VVSGPPMSVFQEYS---TRHI-------- 267

  Fly   161 GNLHEPPSYTLAQ---LTQVLAKGSDNSVTPEFAQHLLHR----QVSKSQLYPDRFFFSR----D 214
            |.|.......|.|   |.:.|...||..:......|  |:    ::|..:|....:.||.    .
  Rat   268 GQLFRSNYIFLFQLPWLPEKLLSLSDFQILKSIFTH--HKKGIPRLSPCELEAFLYPFSHPGGLS 330

  Fly   215 GRVKYYSHL----QMEPEFGEALVKRIRRIPCLIIKGSKSDFVEARTEKAVAILRQNNPHF---- 271
            |.:.||.::    .:||       |.:.: |.|::.|.|...::....:|:      ..||    
  Rat   331 GPINYYRNVFRNFPLEP-------KELSK-PTLLLWGEKDFSLQQGLVEAI------ESHFVPGR 381

  Fly   272 -EFYEVEGGTHHVHLHAAEECARYIVPFIR 300
             |.:.:.|..|.:.....||..:|:..|::
  Rat   382 LESHILPGSGHWIPQSHPEEMHQYMWAFLQ 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 60/290 (21%)
Abhydrolase 47..>109 CDD:304388 14/61 (23%)
Ephx3NP_001102458.1 MhpC 133..406 CDD:223669 58/283 (20%)
Abhydrolase 140..413 CDD:304388 60/290 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.