DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and ABHD14A

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_056222.2 Gene:ABHD14A / 25864 HGNCID:24538 Length:271 Species:Homo sapiens


Alignment Length:246 Identity:55/246 - (22%)
Similarity:84/246 - (34%) Gaps:85/246 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRIPAP-------WGH-----ISGRWYGN---------------RTERPILAIHGWLDNLGTFDR 46
            |.:|.|       ||.     ::|...||               |.|  ::.:||...|..|:::
Human    50 VGLPGPPEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVE--VVLLHGKAFNSHTWEQ 112

  Fly    47 L--IPLLPD--YIGVLCIDLPGHGRSAHIQPGMHYA--------------VNDYVLIIPRVMKEY 93
            |  :.||..  |..| .:||||.|.||..:.....|              |.:.||:.|.:...|
Human   113 LGTLQLLSQRGYRAV-ALDLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHY 176

  Fly    94 GWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKY--LNHSLDKHLVEEE 156
            ....:....|.|.|.:....||....|.:...::       |.| |:|.|  |:|.|.:..:.:.
Human   177 ALPFLMRGHHQLHGFVPIAPTSTQNYTQEQFWAV-------KTP-TLILYGELDHILARESLRQL 233

  Fly   157 RQVEGN-------------LHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHL 194
            |.:..:             ||:|..:.|..|.              |..||
Human   234 RHLPNHSVVKLRNAGHACYLHKPQDFHLVLLA--------------FLDHL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 45/199 (23%)
Abhydrolase 47..>109 CDD:304388 21/79 (27%)
ABHD14ANP_056222.2 MhpC 74..270 CDD:223669 47/220 (21%)
Abhydrolase_5 97..250 CDD:289465 37/161 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.