DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and EPHX4

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_775838.3 Gene:EPHX4 / 253152 HGNCID:23758 Length:362 Species:Homo sapiens


Alignment Length:312 Identity:62/312 - (19%)
Similarity:112/312 - (35%) Gaps:80/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNRTERPILAIHG-------WLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRS---AHIQPGMHYA 78
            |.|.:..:|.:||       |...|..|.      .:| .|:.:||.|:|.:   .|.|   :|.
Human    89 GERGKPLMLLLHGFPEFWYSWRYQLREFK------SEY-RVVALDLRGYGETDAPIHRQ---NYK 143

  Fly    79 VNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKY 143
            ::..:..|..::...|:||..|:||..||:|:::.....|:.|..:|.::.     ..|....:|
Human   144 LDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVMKLIVINF-----PHPNVFTEY 203

  Fly   144 -LNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEF---------AQHLL--H 196
             |.|             ...|.:...|...|:...          |||         .:||.  |
Human   204 ILRH-------------PAQLLKSSYYYFFQIPWF----------PEFMFSINDFKVLKHLFTSH 245

  Fly   197 R--------QVSKSQLYPDRFFFSR----DGRVKYYSHL-QMEPEFGEALVKRIRRIPCLIIKGS 248
            .        |::...|....:.||:    .|.:.:|.:: ...|     |...:...|.|::.|.
Human   246 STGIGRKGCQLTTEDLEAYIYVFSQPGALSGPINHYRNIFSCLP-----LKHHMVTTPTLLLWGE 305

  Fly   249 KSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFIR 300
            ...|:|....:...|..:|  :|....:...:|.:.....:...:.|..|::
Human   306 NDAFMEVEMAEVTKIYVKN--YFRLTILSEASHWLQQDQPDIVNKLIWTFLK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 60/307 (20%)
Abhydrolase 47..>109 CDD:304388 18/64 (28%)
EPHX4NP_775838.3 MhpC 76..350 CDD:223669 60/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.