DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and EPHX2

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001970.2 Gene:EPHX2 / 2053 HGNCID:3402 Length:555 Species:Homo sapiens


Alignment Length:315 Identity:70/315 - (22%)
Similarity:123/315 - (39%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WYGNRTERPILAIHGWLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQPGMHYAVNDYVLII 86
            ||..|.:.|.||..|:                  .||.:|:.|:|.|:.......|.:......:
Human   271 WYSWRYQIPALAQAGY------------------RVLAMDMKGYGESSAPPEIEEYCMEVLCKEM 317

  Fly    87 PRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDI-LLPLSKD--PKTVIKYLNHSL 148
            ...:.:.|.|:...:||..||::.:......|:.|..|.||:. .:|.:.:  |...|| .|...
Human   318 VTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIK-ANPVF 381

  Fly   149 DKHLVEEERQV-EGNLHEPPSYTLAQLTQVLAKGSDNSV---------------TPEFAQHLLHR 197
            |..|..:|..| |..|.:    .|::..:.|.:.||.||               :||  :..|.|
Human   382 DYQLYFQEPGVAEAELEQ----NLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPE--EPSLSR 440

  Fly   198 QVSKS--QLYPDRFFFSR-DGRVKYYSHLQMEPEFGEALVKRIRRIPCLIIKGSKSDFVEARTEK 259
            .|::.  |.|..:|..|. .|.:.:|.:::...::....:.|...||.|::...| |||      
Human   441 MVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEK-DFV------ 498

  Fly   260 AVAILRQNN----PHFEFYEVEGGTHHVHLHAAEECARYIVPFIRH--HRPPALT 308
            .|..:.|:.    ||.:...:|...|...:....|..:.::.::..  ..||.::
Human   499 LVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVS 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 65/300 (22%)
Abhydrolase 47..>109 CDD:304388 13/61 (21%)
EPHX2NP_001970.2 Phosphatase 1..224
HAD_sEH-N_like 3..214 CDD:319790
Phosphate binding. /evidence=ECO:0000269|PubMed:15096040 123..124
Epoxide hydrolase 235..555 70/315 (22%)
Abhydrolase_1 259..531 CDD:395444 67/291 (23%)
Microbody targeting signal. /evidence=ECO:0000255 553..555 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.