DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and K08D9.4

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001305193.1 Gene:K08D9.4 / 187147 WormBaseID:WBGene00019525 Length:311 Species:Caenorhabditis elegans


Alignment Length:298 Identity:59/298 - (19%)
Similarity:100/298 - (33%) Gaps:112/298 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILAIHGWLDNLGTF----DRLIPLLPDYIGVLCIDLPGHGRSAHIQPGMHYA---VNDY------ 82
            ::..||...:...|    .||..:...:||   |:.||. :.....||.|:.   .|.|      
 Worm    52 VIGFHGTPGSHRDFKYVRQRLEHMNIRFIG---INYPGF-KQTPAYPGQHFGNWERNSYSEALLN 112

  Fly    83 VLIIPRVMKEYGWSKVSLMGHSLG--------------GIISFVYTSL------APDTVDMVISL 127
            .|.:|        .||.:||||.|              |::....|.|      .|..     .|
 Worm   113 ELDVP--------GKVIIMGHSRGCENALITAANRKPHGLVMANPTGLRINKGSRPKG-----KL 164

  Fly   128 DILLPLSKD-PKTVIKYLNHSLDK------HLVEE-------------ERQVEG--NLHEPPSYT 170
            :.|:.|.|. ||.:...:.::|.|      |..||             |:|:|.  .|:|.|:.|
 Worm   165 ESLIYLHKKLPKKIGDAILYNLMKLVGFKIHDGEEAVAVIRAIMNCDLEKQLEYILKLNELPTKT 229

  Fly   171 LAQLTQVLAKGSDNSVTPEFAQHLLHRQVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGEALVK 235
            :     :...|||         ||:.:::          .|....:.:..:|...:..       
 Worm   230 M-----ITFGGSD---------HLIEKEI----------VFEALKKYQGLAHFNFKAN------- 263

  Fly   236 RIRRIPCLIIKGSKSDFVEA-RTEKAVAILRQNNPHFE 272
                    |.:..|...:|: :.:|..::....:.||:
 Worm   264 --------ITESEKQKIMESFKNQKGTSVFIAKDNHFQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 59/298 (20%)
Abhydrolase 47..>109 CDD:304388 21/84 (25%)
K08D9.4NP_001305193.1 DUF1057 15..310 CDD:115027 59/298 (20%)
MhpC 46..258 CDD:223669 52/246 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.