DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and abhd-11.1

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_492942.1 Gene:abhd-11.1 / 185192 WormBaseID:WBGene00009316 Length:297 Species:Caenorhabditis elegans


Alignment Length:293 Identity:71/293 - (24%)
Similarity:105/293 - (35%) Gaps:81/293 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YGNRTER--PILAIHGWLDNLGTFDRLIPL---LPDYIG--VLCIDLPGHGRSAHIQPGMHY--A 78
            :||...:  |::.:.|.   .||.:..|.:   |...:|  |..::...|| |......|.|  .
 Worm    28 FGNMRSKGTPLILVPGL---FGTKENWIQVGKDLSQRLGCMVFAVENRNHG-SFSKAASMTYEEM 88

  Fly    79 VNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKY 143
            .:|.|..|..|.|..|..||:|.|||:||   ...|.||                     |..:|
 Worm    89 ADDLVGFIDWVRKITGEDKVNLHGHSMGG---KAVTQLA---------------------TTPEY 129

  Fly   144 LNHSLDKHLVEEERQVEGNLHEPPSYTLAQ------LTQVLAKGSDNSVTPEFAQHLLHRQVSKS 202
              .|..|.|:.|:.       .|..|.|.:      :.|::|...:.|.:...|:  |..:|||.
 Worm   130 --SSRIKSLIVEDM-------SPLGYPLKRAEYLECIKQMIATDMNKSRSEVMAE--LGEKVSKV 183

  Fly   203 QLYPDRFFFSR-------DGRVKYYSHLQMEPEFGEALVKRIRRI-----PCLIIKGSKSDFVEA 255
            .||.    |.|       :|:..:..:|.:..|....|:....|.     |.|..:...|.|:.|
 Worm   184 LLYQ----FVRGNLGEDVNGKAHWICNLNVIDETYIYLLSHDIRFGVFDGPTLFQRAPGSGFLPA 244

  Fly   256 ----RTEKAVAILRQNNPHFEFYEVEGGTHHVH 284
                |.||..       |..:|.|.....|.:|
 Worm   245 AHKNRVEKMF-------PMVQFAETAWSNHWIH 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 69/287 (24%)
Abhydrolase 47..>109 CDD:304388 23/68 (34%)
abhd-11.1NP_492942.1 PRK10673 36..287 CDD:182637 69/285 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.