DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and B0464.9

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_499084.1 Gene:B0464.9 / 181999 WormBaseID:WBGene00007188 Length:364 Species:Caenorhabditis elegans


Alignment Length:47 Identity:16/47 - (34%)
Similarity:23/47 - (48%) Gaps:4/47 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 EVEGGTHHVHL-HAAEECARYIVPFIRHHRPPALTSWSLSGKEEHLS 320
            :::..|.||.. |...:..|..|   .|.|||.:.|.|.|||:..:|
 Worm    11 DLQSETSHVTTPHRQNDLLRQAV---THGRPPPVPSTSTSGKKREMS 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 6/27 (22%)
Abhydrolase 47..>109 CDD:304388
B0464.9NP_499084.1 Fe-S_biosyn 49..>89 CDD:294282 2/6 (33%)
MhpC 68..337 CDD:223669
Abhydrolase_5 89..>190 CDD:289465
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.