powered by:
Protein Alignment CG15879 and B0464.9
DIOPT Version :9
Sequence 1: | NP_647694.1 |
Gene: | CG15879 / 38274 |
FlyBaseID: | FBgn0035309 |
Length: | 342 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499084.1 |
Gene: | B0464.9 / 181999 |
WormBaseID: | WBGene00007188 |
Length: | 364 |
Species: | Caenorhabditis elegans |
Alignment Length: | 47 |
Identity: | 16/47 - (34%) |
Similarity: | 23/47 - (48%) |
Gaps: | 4/47 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 275 EVEGGTHHVHL-HAAEECARYIVPFIRHHRPPALTSWSLSGKEEHLS 320
:::..|.||.. |...:..|..| .|.|||.:.|.|.|||:..:|
Worm 11 DLQSETSHVTTPHRQNDLLRQAV---THGRPPPVPSTSTSGKKREMS 54
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.