DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15879 and F35H12.5

DIOPT Version :9

Sequence 1:	NP_647694.1	Gene:	CG15879 / 38274	FlyBaseID:	FBgn0035309	Length:	342	Species:	Drosophila melanogaster
Sequence 2:	NP_001024631.1	Gene:	F35H12.5 / 180442	WormBaseID:	WBGene00018077	Length:	357	Species:	Caenorhabditis elegans

Alignment Length:	124	Identity:	26/124 - (20%)
Similarity:	49/124 - (39%)	Gaps:	41/124 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly    55 IGVLCIDLPGHGRSAHIQPGMHYAV-----NDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYT 114
            |.::|.:.||   |..:..|:|.:.     |.|:..:...::....:::.:||||.||..:...|
Worm    99 IRLICTNYPG---SEFVTGGLHNSYTNQDRNSYMKSLMETLELKNVNRLIIMGHSRGGENALQLT 160

  Fly   115 SL--------------------AP--------DTVDMVISLDILLPLSKDPKTVIKYLN 145
            |:                    ||        .|::.:|||     :.:..||:...|:
Worm   161 SMLSNDENWPLVGAVMINSPGFAPHKGISKRMGTINFIISL-----IKRHNKTINSILH 214

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15879	NP_647694.1	MhpC	29..302	CDD:223669	26/124 (21%)
CG15879	NP_647694.1	Abhydrolase	47..>109	CDD:304388	15/58 (26%)
F35H12.5	NP_001024631.1	DUF1057	37..348	CDD:115027	26/124 (21%)
F35H12.5	NP_001024631.1	MhpC	53..349	CDD:223669	26/124 (21%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C160156723
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930