DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and ceeh-2

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001256211.1 Gene:ceeh-2 / 179444 WormBaseID:WBGene00010628 Length:355 Species:Caenorhabditis elegans


Alignment Length:272 Identity:47/272 - (17%)
Similarity:97/272 - (35%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CIDLPGHGRSAHIQPGMHYAVNDYVLI-----IPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAP 118
            ||.:...|.:...:|.   .::||.|.     |.:.::.....:|:|..|..|.|:.:....|..
 Worm   105 CIAIDMRGYNTTDRPS---GISDYNLTHLVEDIRQFIEILELKRVTLAAHDWGAIVCWRVAMLHS 166

  Fly   119 DTVDMVISLDILLP--------LSKDPKTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLT 175
            :.:|.::..::..|        :||:.:....|: :......:.|.......:         ::.
 Worm   167 NLIDRLVICNVPHPFAFFEVYNMSKEQRNKSWYI-YLFQSQYIPEIAMRSNKM---------KML 221

  Fly   176 QVLAKGSDNSVTPEFAQHLLHRQVSKSQLYPD------RFFFSR----DGRVKYYSHLQMEPEFG 230
            :.:.:||...             :..|:.:.|      :..||:    .|.:.||..|...|...
 Worm   222 EAMFRGSKAG-------------IRNSENFTDEDMLAWKHVFSQPGGTTGPLNYYRDLFNAPAIP 273

  Fly   231 EALVKRIRRIPCLIIKGSKSDFVEAR-TEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARY 294
            ..|  :|.:...||:.|.:..|::.: .|.:|...|......    :.|.:|.|.....:....|
 Worm   274 RKL--QIVQPKVLILWGDEDAFLDKKGAELSVQFCRDCRVQM----IRGASHWVQQDQPQLVNVY 332

  Fly   295 IVPFIRH--HRP 304
            :..|:..  :||
 Worm   333 MEQFMNEDSYRP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 45/268 (17%)
Abhydrolase 47..>109 CDD:304388 12/54 (22%)
ceeh-2NP_001256211.1 Abhydrolase 63..>210 CDD:304388 19/108 (18%)
Abhydrolase_1 77..322 CDD:278959 42/248 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156750
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.