DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and Y73C8B.3

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_503878.2 Gene:Y73C8B.3 / 178756 WormBaseID:WBGene00022260 Length:328 Species:Caenorhabditis elegans


Alignment Length:247 Identity:49/247 - (19%)
Similarity:84/247 - (34%) Gaps:100/247 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LAIHGWLD---NLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQPGMHYAVNDYVLIIPRVMKEY 93
            |.||..::   .:.|.|.:..:||.::|                       |..:|   .|.|.:
 Worm   160 LRIHKGINPISRMTTVDSIYKMLPLFLG-----------------------NAMML---GVYKAF 198

  Fly    94 GW----------SKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYLNHSL 148
            |:          |..|::..||||.:.|:     ..|.||.:. .:::...||            
 Worm   199 GFKITTGEEAVNSMRSMINVSLGGQLEFI-----EKTNDMNVK-KLIVFAGKD------------ 245

  Fly   149 DKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHL-LHRQVSKSQLYP--DRFF 210
              ||||||...|         ||.:              .|..||. :.:::|:::...  |.|.
 Worm   246 --HLVEEEIVFE---------TLEK--------------HEGLQHFNIDKEISEAERLKILDSFT 285

  Fly   211 FSRDGR---VKYYSHLQMEPEFGEALVKRIRRIPCLIIKGSKSDFVEARTEK 259
            .::.|.   |...:|.|.:...|            |:.:..|:.|...:|.:
 Worm   286 GTQRGASVFVAQDNHFQNKSRAG------------LVAEACKAMFENEKTSR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 49/247 (20%)
Abhydrolase 47..>109 CDD:304388 14/71 (20%)
Y73C8B.3NP_503878.2 DUF1057 23..319 CDD:115027 47/239 (20%)
MhpC 54..>157 CDD:223669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.