DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and K01A2.5

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_493701.1 Gene:K01A2.5 / 173418 WormBaseID:WBGene00019280 Length:265 Species:Caenorhabditis elegans


Alignment Length:231 Identity:55/231 - (23%)
Similarity:80/231 - (34%) Gaps:98/231 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSDF-------KEVRIP-APWGHISGRWYGNRTERPILAIHGWLDNLGTFDRLIPLL------ 51
            |:.||:       |:.:|. ..:||  |..|       ||||.|   .:|.:.:..||.      
 Worm     1 MTQSDYIESSEHIKDTQIGYCKYGH--GPNY-------ILAICG---AVGCYKKDWPLKLLSHFP 53

  Fly    52 PDYIGVLCIDLPGHG------RSAHIQPGMHYAVNDYVLIIPRVMK-----EYGWS--------- 96
            ||.:.::.||.||:|      |...:|..|  ..::|.|.:...:|     ..|||         
 Worm    54 PDQVTIVGIDPPGYGTSRPPERKQEVQRCM--KDSEYCLGLMETLKLEPFTVMGWSEGARTTVHV 116

  Fly    97 ------KVSLMGHSLG-------GIISF-------------------------VYTSLAP--DTV 121
                  ||:.|....|       |.::|                         :.|..|.  |.|
 Worm   117 AAKGKEKVNRMIVMAGATKVNHLGAMAFKGMRETNHWLAAGRQPYLDHYSPETLRTQWAALCDVV 181

  Fly   122 DMVISL-------DILLPLSKDPKTVIKYLNHSLDK 150
            |.|.|.       |::||..|.|..|   :|..||:
 Worm   182 DQVHSFCGGRFPCDLVLPQVKCPTLV---MNGGLDR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 46/195 (24%)
Abhydrolase 47..>109 CDD:304388 23/100 (23%)
K01A2.5NP_493701.1 MhpC 59..261 CDD:223669 36/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.