DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and Mest

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001239221.1 Gene:Mest / 17294 MGIID:96968 Length:342 Species:Mus musculus


Alignment Length:243 Identity:50/243 - (20%)
Similarity:91/243 - (37%) Gaps:69/243 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VLCIDLPGHGRSAHIQPGMHYAVNDYVLIIPRVMKEYGWS--KVSLMGHSLGGIIS----FVYTS 115
            |:.:|..|.|.|...:| ..|::.:...|:..:::..|..  :::|:.|..|.|::    :.|..
Mouse   106 VIALDFLGFGFSDKPRP-HQYSIFEQASIVESLLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQ 169

  Fly   116 LAPDTV---DMVISLDILLPLSKDPKTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQ- 176
            .....:   .:.:|...:.|.:..|..:.|.|.              :|.:..|   .|.:|.. 
Mouse   170 NRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLK--------------DGGVLSP---ILTRLMNF 217

  Fly   177 -VLAKGSDNSVTPEFAQHLLHRQVSKSQLYPDRFFFSR--DGRVKYYSHLQMEPEFGEALVKRIR 238
             |.::|    :||.|..   :.:.::|:|: |.:...|  ||.:...|.||...:     .|:.|
Mouse   218 FVFSRG----LTPVFGP---YTRPTESELW-DMWAVIRNNDGNLVIDSLLQYINQ-----RKKFR 269

  Fly   239 R----------IPCLIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEV 276
            |          ||...|.|.               |...||:.||.|:
Mouse   270 RRWVGALASVSIPIHFIYGP---------------LDPINPYPEFLEL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 50/243 (21%)
Abhydrolase 47..>109 CDD:304388 12/53 (23%)
MestNP_001239221.1 MhpC 54..328 CDD:223669 50/243 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.