DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15879 and ephx4

DIOPT Version :9

Sequence 1:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_002933851.2 Gene:ephx4 / 100492111 XenbaseID:XB-GENE-983897 Length:361 Species:Xenopus tropicalis


Alignment Length:311 Identity:57/311 - (18%)
Similarity:107/311 - (34%) Gaps:72/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNRTERPILAIHG-------WLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAHIQPGMHYAVND 81
            |.|.:..:|.:||       |...|..|.      .:| .|:.:||.|:|.:........|.::.
 Frog    87 GERGKPLMLLLHGFPEFWYSWRHQLREFK------SEY-RVVALDLRGYGETDAPTNIDSYKLDC 144

  Fly    82 YVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSKDPKTVIKYLNH 146
            .::.:..::...|::|..|:||..||:|:::.....|:.|..:|.|....|      ||.     
 Frog   145 IIVDVKEIVDSLGYTKCVLIGHDWGGMIAWLTAICYPEMVTKLIVLSFPHP------TVF----- 198

  Fly   147 SLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHLLHRQVSKSQLYPDRFFF 211
                                ..|.|...:|::..|........:...|:: .|:..::..|.|..
 Frog   199 --------------------TEYILRHPSQLIKSGYYFFFQMPWFPELMY-TVNDYKVLKDLFTS 242

  Fly   212 SRDGRVKY-----------YSHLQMEPEFGEALVKRIRRI-------------PCLIIKGSKSDF 252
            :..|..|:           |.::..:|......:...|.|             |.|::.|....|
 Frog   243 TDTGIGKHGCRFTEEDMEAYLYIFSQPGALSGPLNHYRNICSCLPLKHHQVTMPTLLLWGENDAF 307

  Fly   253 VEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFIRHHR 303
            ||....:...:..:|  :|:...:...:|.:.....|.....|..|:...|
 Frog   308 VEVEMAELTRVYVKN--YFQLSVLSYASHWIQQDQPELVNTLIWTFLEEDR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15879NP_647694.1 MhpC 29..302 CDD:223669 54/303 (18%)
Abhydrolase 47..>109 CDD:304388 14/61 (23%)
ephx4XP_002933851.2 Abhydrolase 64..>189 CDD:304388 25/108 (23%)
MhpC 78..348 CDD:223669 54/301 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.