DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1139 and SLC38A7

DIOPT Version :9

Sequence 1:NP_647686.1 Gene:CG1139 / 38264 FlyBaseID:FBgn0035300 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001356537.1 Gene:SLC38A7 / 55238 HGNCID:25582 Length:462 Species:Homo sapiens


Alignment Length:458 Identity:103/458 - (22%)
Similarity:175/458 - (38%) Gaps:118/458 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LKASVGTGVLAMPSAFAHAGYV-------NGTLLTLIIGSLAL-YCLHILIKCMYILCKRQRVPY 109
            :.|.:|.|:|..|:||:.||.|       .|.|:.:|.|.:.| ||                   
Human    61 VNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISGLVILAYC------------------- 106

  Fly   110 VSFSQAMNLGLKQGPPWLRC------LAPIAVPFVDGFLAFYHFGICCVYVVFIAESIKQLVDEY 168
               |||.|....|...|..|      |..:|:       |.|.||.|..:::.|.:.    .|:.
Human   107 ---SQASNERTYQEVVWAVCGKLTGVLCEVAI-------AVYTFGTCIAFLIIIGDQ----QDKI 157

  Fly   169 LVV-----------WDVRIHMCIIIVPLLLIYSIKNLKLLAP----FSSAANLLLLVGFG----- 213
            :.|           |.......|.:...|.|     |.|..|    |...|:.|.:||..     
Human   158 IAVMAKEPEGASGPWYTDRKFTISLTAFLFI-----LPLSIPREIGFQKYASFLSVVGTWYVTAI 217

  Fly   214 IILYYIF--EELPP---LSERDPFVAA-GKLPTFFGTVLFALEAVGVILAIEENMATP--KSFVG 270
            :|:.||:  :|:.|   |:....::|. ..:|    |:.|..:.....:.:..:|..|  |::  
Human   218 VIIKYIWPDKEMTPGNILTRPASWMAVFNAMP----TICFGFQCHVSSVPVFNSMQQPEVKTW-- 276

  Fly   271 PCGILNSGMSIVLGLYVLLGFFGYWKYGNESEGSITLNIPQSEIPAQVVKVFFAITTWISYALQ- 334
             .|::.:.|.|.|.:|:..|..|:..:|...:..:.|:.|..::...|.:.|..::...||.:. 
Human   277 -GGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILH 340

  Fly   335 --GYVTAHILWDKYLAKRFKET--RQTFYELIFRAIIVLLTFGCAVAIPDLSVFLSLVGSFCLSI 395
              |......||.:|.....:|.  |:....::...:..|||...|:.|||:...:|::|......
Human   341 FCGRAVVEGLWLRYQGVPVEEDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACF 405

  Fly   396 LGLIFPVLLQICVQYTE-------------GYGPFRIKLIINLLLLCFG--IFGGVVGTYVSILD 445
            : .:||.|..|..:.:|             .||         :||:..|  |||......: .:|
Human   406 I-FVFPGLCLIQAKLSEMEEVKPASWWVLVSYG---------VLLVTLGAFIFGQTTANAI-FVD 459

  Fly   446 IIA 448
            ::|
Human   460 LLA 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1139NP_647686.1 SdaC 36..404 CDD:223884 90/397 (23%)
SLC5-6-like_sbd 42..444 CDD:294310 101/452 (22%)
SLC38A7NP_001356537.1 SLC5-6-like_sbd 49..457 CDD:320982 101/451 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158600
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.