DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1139 and Slc38a8

DIOPT Version :9

Sequence 1:NP_647686.1 Gene:CG1139 / 38264 FlyBaseID:FBgn0035300 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_006255783.1 Gene:Slc38a8 / 502208 RGDID:1560237 Length:476 Species:Rattus norvegicus


Alignment Length:407 Identity:92/407 - (22%)
Similarity:164/407 - (40%) Gaps:77/407 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LKASVGTGVLAMPSAFAHAGYVNGTLLTLIIGSLALYCLHILIKCMYILCKRQRVPYVSFSQAMN 117
            ||:::|.|:|..|.||..||   |.:.|.::   ||..|..||..:.||.....|.    .|...
  Rat    34 LKSALGAGLLNFPWAFYKAG---GLVPTFLV---ALVSLVFLISGLVILGYAASVS----GQTTY 88

  Fly   118 LGLKQ---GPP--------WLRCLAPIAVPFVDGFLAFYHFGICCVYVVFIAESIKQLVDEYL-- 169
            .|:.:   ||.        :|..|..|:|.|:.                .|.:.:::|.|..|  
  Rat    89 QGVVRELCGPAMGKLCEACFLTNLLMISVAFLR----------------VIGDQLEKLCDSLLPD 137

  Fly   170 --VVWDVRIHMCIIIVPLLLIYSIKNLK--LLAPFSSAANLLLLVGFGIIL---YYIF-----EE 222
              ..|.......:.::.:|:|:.:..|:  .|..::|....|......:::   ||::     .:
  Rat   138 APQPWYAAQSFTLPLISVLVIFPLSALRDIALQEYTSILGTLAACYLALVITVQYYLWPQGLIRQ 202

  Fly   223 LPPLSERDPFVAAGKLPTFFGTVLFAL---EAVGVILAIEENMATPKSFVGPCGILNSGMSIVLG 284
            ..||....|:.:...:   |.|:.|..   ||...|....:|.:.|.      ..|.|.:|::..
  Rat   203 PGPLLSPSPWTSVFSV---FPTICFGFQCHEAAVSIYCSMQNQSLPH------WTLVSVLSLMAC 258

  Fly   285 --LYVLLGFFGYWKYGNESEGSITLNIPQSEIPAQVVKVFFAITTWISYALQGYVTAHILWDKYL 347
              :|.|.|.:|:..:|.|....|.::.|.::....|.:|.||::....|.:..::...::.| :.
  Rat   259 CLVYTLTGVYGFLTFGTEVSADILMSYPGNDTAIIVARVLFAVSIVTVYPIVLFLGRSVMQD-FW 322

  Fly   348 AKRFKETRQT---------FYELIFRAIIVLLTFGCAVAIPDLSVFLSLVGSFCLSILGLIFPVL 403
            .|.:..|:.:         :..|....:.|.:|...|:.:||||..:.::|......: .|||.|
  Rat   323 KKSYWATQGSPVLADPSGPWVRLPLTFLWVAVTLAMALFLPDLSEIIGVIGGLSAFFI-FIFPGL 386

  Fly   404 LQICVQYTEGYGPFRIK 420
            ..|....||..|| |:|
  Rat   387 CLISAVDTEPIGP-RVK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1139NP_647686.1 SdaC 36..404 CDD:223884 84/389 (22%)
SLC5-6-like_sbd 42..444 CDD:294310 92/407 (23%)
Slc38a8XP_006255783.1 SLC5-6-like_sbd 29..386 CDD:294310 84/388 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352551
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.