DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1139 and Slc38a11

DIOPT Version :9

Sequence 1:NP_647686.1 Gene:CG1139 / 38264 FlyBaseID:FBgn0035300 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001363948.1 Gene:Slc38a11 / 362141 RGDID:1306005 Length:464 Species:Rattus norvegicus


Alignment Length:434 Identity:79/434 - (18%)
Similarity:156/434 - (35%) Gaps:108/434 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HQHRELKNPTTNFQTFAHF--LKASVGTGVLAMPSAFAHAGYVNGTLLTLIIGSLALYCLHILIK 96
            |:|....:     |:.|.|  :.:.:|:|::.:|.:...||:..|.||...:..:..:.|.:|||
  Rat    28 HEHGGKSS-----QSAAVFNVVNSVIGSGIIGLPYSMKQAGFPLGILLLFWVSYITDFSLVLLIK 87

  Fly    97 CMYILCKRQRVPYVSFSQAMNLGLKQGPPWLRCLAPIAVPFVDGFLA------FYHFGICCVYVV 155
            .                     |...|....:.|......| .|:|.      .|.|.....|.:
  Rat    88 G---------------------GALSGTDSYQSLVNKTFGF-PGYLLLSTLQFMYPFIAMISYNI 130

  Fly   156 FIAESIKQLVDEYLVV----WDVRIHMCIII------VPLLLIYSIKNLKLLAPFSSAANLLLLV 210
            ...:::.::......|    |.:..|..|::      :||.|   .:::..|...|..:.:|..|
  Rat   131 ITGDTLSKVFQRLPGVDPGSWFISRHFIIVVSTVTCTLPLSL---YRDIAKLGKISFISTILTAV 192

  Fly   211 GFGIILYYIFEELPPLSERD-PFVAAGKLPTFFGTVLFALEAVGVILAIEENMATPKSFVGPC-- 272
            ..|:::.......|.:.:.| .:|.|  .|.       |::|:||:           ||...|  
  Rat   193 ILGVVVTRTISLGPNIPKTDNAWVFA--RPN-------AIQAIGVM-----------SFAFICHH 237

  Fly   273 ------------------GILNSGMSIVLGLYVLLGFFGYWKYGNESEGSITLNIPQSEIPAQVV 319
                              .::::.:.:.:.:.||....||:.:...::|.:..|..:|:......
  Rat   238 NCFLVYGSLEEPTVAKWRRVIHTSILVSVFICVLFATCGYFTFTGFTQGDLFENYCRSDDLVTFG 302

  Fly   320 KVFFAITTWISYALQGYVTAHILWDKYLAKRFKETRQTFYELIFRAIIVLLTFGCAVAIPDLSVF 384
            :..:.||..::|.::.:||..::.:.:......   ..|:..:..||:...|. .::.|..|.:.
  Rat   303 RFCYGITVILTYPIECFVTREVITNVFFGGALS---SVFHVTLTAAIVTAATL-ISLLIDCLGIV 363

  Fly   385 LSLVGSFCLSILGLIFPVL---------------LQICVQYTEG 413
            |.|.|..|.:.|..|.|..               |..||.:..|
  Rat   364 LELNGVLCAAPLIFIIPSACYLKLSEEPRTHSDKLMACVMFPVG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1139NP_647686.1 SdaC 36..404 CDD:223884 74/421 (18%)
SLC5-6-like_sbd 42..444 CDD:294310 77/426 (18%)
Slc38a11NP_001363948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 2/5 (40%)
SLC5-6-like_sbd 32..420 CDD:382020 77/430 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.