DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1139 and Slc38a5

DIOPT Version :9

Sequence 1:NP_647686.1 Gene:CG1139 / 38264 FlyBaseID:FBgn0035300 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_008771290.2 Gene:Slc38a5 / 192208 RGDID:620702 Length:479 Species:Rattus norvegicus


Alignment Length:479 Identity:94/479 - (19%)
Similarity:176/479 - (36%) Gaps:85/479 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNDDIKT--VTVYPTTLELTTPTKSANGSNDDYDPHQHRELKNPTTNFQTFAHFLKASVGTGVLA 63
            ||..:.|  ...|....|...||  .:|......|.|..:.:..|:...:..:...|.:|:|:|.
  Rat    16 MNGTLSTGAAAGYRQEREGFLPT--THGPAPGRKPVQFLDFEGKTSFGMSVFNLSNAIMGSGILG 78

  Fly    64 MPSAFAHAGYVNGTLLTLIIGSLALYCLHILIKCMYILCKRQRVPYVSFSQAMNLGLKQGPPWLR 128
            :..|.||.|.:....|.|.|..|:.|.:|:|:.|..::..|   .|....|             |
  Rat    79 LAYAMAHTGVIFFLALLLCIALLSSYSIHLLLTCASVVGIR---AYEQLGQ-------------R 127

  Fly   129 CLAPIAVPFVDGFLAFYHFGICCVYVVFIAESIKQLVDEYLVV-----WDVRIHMCIIIVPLLLI 188
            ...|.....|...:..::.|....|:..|...:..::..:|.:     |.::.::.||:|.||:|
  Rat   128 AFGPAGKVVVAIIICLHNVGAMSSYLFIIKSELPLVIGTFLHMDPEGDWFLKGNLLIILVSLLII 192

  Fly   189 YSIKNLKLLA--PFSSAANLLLLVGFGI-ILYYIFEELPPLSERDPFVAAGKLPTFFGTVLFALE 250
            ..:..:|.|.  .::|:.:|..::.|.| ::|..|:....:|..|..|.:...|    ...|...
  Rat   193 LPLALMKHLGYLGYTSSLSLTCMLFFLISVIYKKFQLGCVVSHNDTVVESEPAP----LQAFNSS 253

  Fly   251 AVGVILAIEENMA--TP-KSFVGPC--------------------GILNSGMSIVLGLYVLLGFF 292
            ....:..::..|:  .| .:|...|                    .:.|..:..:..:|.|...|
  Rat   254 CEAKLFTVDSQMSYTVPIMAFAFVCHPEVLPIYTELCCPTQRRMQAVANMSIGAMFIMYGLTATF 318

  Fly   293 GYWKYGNESEGSITLNIPQSEIPAQVVK--VFFAITTW-------ISYALQGYVTAHILWDKYLA 348
            ||..:.:..:..:.....|.::....|:  |..|:|..       |..|||..:        :.:
  Rat   319 GYLTFYSTVKAEMLEMYTQEDLLILCVRLAVLLAVTLTVPVVLFPIRRALQQLL--------FPS 375

  Fly   349 KRFKETRQTFYELIFRAIIVLLTFGCAVAIPDLSVFLSLVGSFCLSILGLIFPVLLQICVQYTEG 413
            |.|...|.....||...::.:|    .:.:|.:......:||.....|..|.|.:..:.:.    
  Rat   376 KAFSWPRHVAIALILLILVNIL----VICVPTIRDIFGFIGSTSAPSLIFILPSVFYLRIV---- 432

  Fly   414 YGPFRIKLIIN---LLLLCFGIFG 434
              |..::.:.:   :..||||:.|
  Rat   433 --PADMEPLFSWPKIQALCFGVLG 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1139NP_647686.1 SdaC 36..404 CDD:223884 78/407 (19%)
SLC5-6-like_sbd 42..444 CDD:294310 84/436 (19%)
Slc38a5XP_008771290.2 SLC5-6-like_sbd 56..466 CDD:382020 84/437 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.